an online Instagram web viewer

#tenebre medias

Photos

Scene near the end of #tenebre where Jane is murdered by the killer
Scene near the end of #tenebre  where Jane is murdered by the killer
Cronache dei vampiri è una serie di romanzi Fantasy/horror della scrittrice statunitense Anne Rice avente come protagonisti i vampiri. 
Libri:
Intervista col vampiro 
Scelti dalle tenebre 
La regina dei dannati 
Il ladro di corpo
Memnoch il diavolo 
Armand il vampiro
Merrick la strega 
Il vampiro Marius 
Il vampiro di Blackwood 
Blood 
Il principe Lestat 
Prince Lestat and the Realms of Atlantis - 2016

Trama:
Il protagonista è Lestat de Lioncourt, un giovane nobile francese diventato vampiro nel XVIII secolo: le sue vicende si intrecciano con quelle di altri che, prima o dopo di lui, hanno ricevuto il dono tenebroso.
Le cronache hanno guadagnato una grande popolarità con il primo libro Intervista col vampiro. Ogni libro si concentra in particolare sulla figura di un vampiro e spesso si riferisce ai fatti avvenuti nei libri precedenti. Questi romanzi hanno un'impronta prevalentemente narrativo-descrittiva e un forte stile riflessivo: si dà ampio spazio ai sentimenti e alle relazioni tra i vampiri, creature che sono in grado di amare come e più di ogni altro uomo. I vampiri talvolta diventano degli attenti osservatori che, al di fuori del tempo, analizzano il susseguirsi delle epoche. Grazie alla sua abilità narrativa la Rice riesce ad inserire i suoi vampiri nel mondo odierno in maniera del tutto verosimile. 
#annarice #vampiri #lestat #dannati #tenebre #librihorror #horror #librivampiri #nobile #librifantasyofficial #librodautore #libristagram #libri #libridaleggere #ioleggo #consiglidilettura #istanbook #libribelli #lovelibri #leggeresempre #leggereovunque #leggere #librifantasy #fantasy #fantasybook
Cronache dei vampiri è una serie di romanzi Fantasy/horror della scrittrice statunitense Anne Rice avente come protagonisti i vampiri. Libri: Intervista col vampiro Scelti dalle tenebre La regina dei dannati Il ladro di corpo Memnoch il diavolo Armand il vampiro Merrick la strega Il vampiro Marius Il vampiro di Blackwood Blood Il principe Lestat Prince Lestat and the Realms of Atlantis - 2016 Trama: Il protagonista è Lestat de Lioncourt, un giovane nobile francese diventato vampiro nel XVIII secolo: le sue vicende si intrecciano con quelle di altri che, prima o dopo di lui, hanno ricevuto il dono tenebroso. Le cronache hanno guadagnato una grande popolarità con il primo libro Intervista col vampiro. Ogni libro si concentra in particolare sulla figura di un vampiro e spesso si riferisce ai fatti avvenuti nei libri precedenti. Questi romanzi hanno un'impronta prevalentemente narrativo-descrittiva e un forte stile riflessivo: si dà ampio spazio ai sentimenti e alle relazioni tra i vampiri, creature che sono in grado di amare come e più di ogni altro uomo. I vampiri talvolta diventano degli attenti osservatori che, al di fuori del tempo, analizzano il susseguirsi delle epoche. Grazie alla sua abilità narrativa la Rice riesce ad inserire i suoi vampiri nel mondo odierno in maniera del tutto verosimile. #annarice  #vampiri  #lestat  #dannati  #tenebre  #librihorror  #horror  #librivampiri  #nobile  #librifantasyofficial  #librodautore  #libristagram  #libri  #libridaleggere  #ioleggo  #consiglidilettura  #istanbook  #libribelli  #lovelibri  #leggeresempre  #leggereovunque  #leggere  #librifantasy  #fantasy  #fantasybook 
repping @frightrags today! major love for this company and it's collections! you don't have to go to Texas for a chainsaw massacre!! -
-
-
-
-
-
-
-

#frightrags #tshirt #pieces #horror #slasher #cult #exploitation #horrorfilm #horrorcollector #gore #gorehound #giallo #me #selfie #scruffy #italian #zombie #tenebre #tattooed #unphotogenic #horrorjunkie
#tenebre was a 1982 giallo-film by @darioargento_official 
Tenebre shocked me when I saw it years ago, tenebre shocked us when we saw it for the fourteenth time last night
#tenebre  was a 1982 giallo-film by @darioargento_official Tenebre shocked me when I saw it years ago, tenebre shocked us when we saw it for the fourteenth time last night
Scusate se ho messo troppo colore❌⚪⚫♥ #tenebre  #fotobiancoenero
Vieni con me le tenebre
Ti passo a prendere
Vedo un po' di libertà nelle mie fobie
Vedo un po' di verità nelle tue bugie
Puoi trovarmi nelle cose che non troverai
Puoi ascoltarmi nel ricordo di quello che sei
Puoi lasciare i tuoi saluti qui in segreteria
Tu che sei parte di tutto ma senza esser mia
E tra le cose che scrivo ho trovato un motivo
Scusa sono indeciso in queste sere
Ma per sentirmi vivo
Ne ho bisogno, ti scrivo
Lascia un posto per me tra le tue tenebre 
#ultimo #sercho #song #likeforlikes #cloudscapes #nebbia #tenebre #badweather #moment #majella #blackandwhite #effettispeciali #filter #rain #work
Vieni con me le tenebre Ti passo a prendere Vedo un po' di libertà nelle mie fobie Vedo un po' di verità nelle tue bugie Puoi trovarmi nelle cose che non troverai Puoi ascoltarmi nel ricordo di quello che sei Puoi lasciare i tuoi saluti qui in segreteria Tu che sei parte di tutto ma senza esser mia E tra le cose che scrivo ho trovato un motivo Scusa sono indeciso in queste sere Ma per sentirmi vivo Ne ho bisogno, ti scrivo Lascia un posto per me tra le tue tenebre #ultimo  #sercho  #song  #likeforlikes  #cloudscapes  #nebbia  #tenebre  #badweather  #moment  #majella  #blackandwhite  #effettispeciali  #filter  #rain  #work 
"«#Sorgi, #risplendi, perché la tua luce è giunta, e la gloria dell'Eterno si è levata su te. Poiché ecco, le #tenebre ricoprono la terra e una fitta oscurità avvolge i popoli; ma su di te si leva l'Eterno e la sua #gloria appare su di te." (Isaia 60:1-2)

Quanto piu si alzano i tuoi #nemici, quanto più le cose non funzionano attorno a te e le difficoltà non fanno che aumentare, tu saprai che questa #oscurità era solo la premessa per una gloria maggiore che doveva alzarsi su di te!
Capirai, alla fine di queste "grandi acque" (Salmo 32:6), che in fin dei conti Egli ti ha sempre  portato sulle Sue spalle per guardare più lontano! 😍

#Incoraggiamento #ConLuiNonSiMolla

#SimoneDiChiara
#Sorgi , #risplendi , perché la tua luce è giunta, e la gloria dell'Eterno si è levata su te. Poiché ecco, le #tenebre  ricoprono la terra e una fitta oscurità avvolge i popoli; ma su di te si leva l'Eterno e la sua #gloria  appare su di te." (Isaia 60:1-2) Quanto piu si alzano i tuoi #nemici , quanto più le cose non funzionano attorno a te e le difficoltà non fanno che aumentare, tu saprai che questa #oscurità  era solo la premessa per una gloria maggiore che doveva alzarsi su di te! Capirai, alla fine di queste "grandi acque" (Salmo 32:6), che in fin dei conti Egli ti ha sempre portato sulle Sue spalle per guardare più lontano! 😍 #Incoraggiamento  #ConLuiNonSiMolla  #SimoneDiChiara 
Some art by Nicola Samori (Italy)
Www.nicolasamori.com

#art #illustration #macabre #paint #painting #peinture #dark #horror #gore #nicolasamori #tenebre #darkness #goth #gothic #gothique #fear #cauchemar #nightmare
Non puoi non guardare oltre, non puoi far finta di non vedere, non puoi dare tutto per scontato. Se c'è un motivo ci sarà una ragione, ed ai tanti sfugge. #buonanotte #buonanottecosì #buonanotte🌙 #notte #tenebre che mi #affascinano
Leggi la recensione del racconto gotico sulla prima 🦇vampira🦇 della storia! 📖
Carmilla di Le Fanu
Articolo di Simone Colaiacomo
STORIE HORROR🕸️ il Blog
Link in bio ☝️
Leggi la recensione del racconto gotico sulla prima 🦇vampira🦇 della storia! 📖 Carmilla di Le Fanu Articolo di Simone Colaiacomo STORIE HORROR🕸️ il Blog Link in bio ☝️
“Qualcuno che ho amato, una volta mi diede una scatola piena di tenebre. Mi ci sono voluti anni per capire che, anche questo, è stato un dono.”
(Mary Oliver)
.
#darkness #lights #night #tenebre #buio #venice #venezia #venicebynight #venicebyvenetians #venezianity #veneziadavivere #darkside #nightscape #nightvision #nighttime #veneto #fears #nofear #bynight #notturno #yallersvenezia #yallersveneto #igersvenezia #igersveneto #veneto_in #new_photoveneto #italiannight
“Qualcuno che ho amato, una volta mi diede una scatola piena di tenebre. Mi ci sono voluti anni per capire che, anche questo, è stato un dono.” (Mary Oliver) . #darkness  #lights  #night  #tenebre  #buio  #venice  #venezia  #venicebynight  #venicebyvenetians  #venezianity  #veneziadavivere  #darkside  #nightscape  #nightvision  #nighttime  #veneto  #fears  #nofear  #bynight  #notturno  #yallersvenezia  #yallersveneto  #igersvenezia  #igersveneto  #veneto_in  #new_photoveneto  #italiannight 
✨ 𝒩𝒾𝑔𝒽𝓉 𝒻𝒶𝓁𝓁𝓈 𝑜𝓃 𝒞𝓊𝓃𝑒𝑜 🌙  Cala la notte su Cuneo _______________________________________________ #cool #dark #fun #coffee #lastnight #latenight #luna #lunar #moon #street #natur #notte #nightsky #nighttime #nite #noche #cuneo #photography #primeshots #cocktail #themoon #viaroma #twlightscapes #bar #italy #trees #light #tenebre #blackandwhite #rain
Il giallo dell'anno, forse del decennio #darioargento #tenebre #tenebrae
❓❗️⁉️
Qual è il vostro personaggio preferito in una saga fantasy?
Quali sono le caratteristiche che deve avere un buon character?
Sbizzarritevi!
Ps. Domani vi presenterò il mio personaggio coprotagonista 😏

#scrittoriitaliani #libriconsigliati #librifantasy #fantasyitalia #fantasilandia #fantasy #fairytale #tenebre #libridaleggere #librichepassione #lettoristraordinari #lettoridiinstagram
️▶ LE TERRIFICANTI AVVENTURE DI SABRINA ️◀️
#sabrinaspellman come non l'avete mai vista. #chillingadventuresofsabrina é la nuova #serie TV  targata  #netflix, offrirà ai telespettatori una versione #dark dell'iconico personaggio #archiecomic per i ragazzi nati negli anni 90 dimenticatevi  la #sitcom con #melissajoanhart, il nuovo show sarà praticamente l  opposto in quanto si baserà soprattutto su l  #horror: viene infatti descritto come un mix tra #rosemarysbaby #lesorcista e un #teendrama. La storia sarà basata sui fumetti di #robertoaguirresacasa, produttore della serie e di #riverdale.
Sabrina, per metà mortale e per metà strega ovvero ( #mezzosangue) dovrà scegliere se seguire la #luce o le #tenebre. Dovrà anche affrontare la vita del liceo, l'amore per #harvey  e le continue  tentazioni provenienti dal lato oscuro. Il mondo della #magia è sempre in agguato e nemici potenti daranno parecchi problemi alla #streghetta
Nel cast del nuovo show, oltre #kiernanshipka e #rosslynch, troveremo: #lucydavis e #mirandaotto
️▶ LE TERRIFICANTI AVVENTURE DI SABRINA ️◀️ #sabrinaspellman  come non l'avete mai vista. #chillingadventuresofsabrina  é la nuova #serie  TV targata #netflix , offrirà ai telespettatori una versione #dark  dell'iconico personaggio #archiecomic  per i ragazzi nati negli anni 90 dimenticatevi la #sitcom  con #melissajoanhart , il nuovo show sarà praticamente l opposto in quanto si baserà soprattutto su l #horror : viene infatti descritto come un mix tra #rosemarysbaby  #lesorcista  e un #teendrama . La storia sarà basata sui fumetti di #robertoaguirresacasa , produttore della serie e di #riverdale . Sabrina, per metà mortale e per metà strega ovvero ( #mezzosangue ) dovrà scegliere se seguire la #luce  o le #tenebre . Dovrà anche affrontare la vita del liceo, l'amore per #harvey  e le continue tentazioni provenienti dal lato oscuro. Il mondo della #magia  è sempre in agguato e nemici potenti daranno parecchi problemi alla #streghetta  Nel cast del nuovo show, oltre #kiernanshipka  e #rosslynch , troveremo: #lucydavis  e #mirandaotto 
👁👄🔪
👁👄🔪
Vi auguriamo la buonanotte con un nostro ultimo post. Ecco Erebo, divinità ancestrale; è una figura presente nei miti della religione greca ed è anche conosciuto come il Dio dell'oscurità. 
È considerato una divinità primordiale in quanto nacque dall'unione tra le Tenebre e il CAOS e dal momento che non esisteva ancora né la LUNA né il SOLE, i genitori procrearono anche il Giorno e la NOTTE. Dato che è la personificazione dell'oscurità, con il termine Erebo si possono indicare anche gli INFERI. Fu una divinità particolarmente prolifica, infatti dalla sua unione con sua sorella Notte nacquero il Fato, l'Aria, la Vecchiaia, la Morte, l'Assassinio, la Continenza, il Sonno, i Sogni, la Discordia, la Miseria, l'Ira, la Nemesi, la Gioia, l'Amicizia, la Pietà, le tre Esperidi, Caronte e le tre MOIRE: Cloti, Lachesi e Atropo
#divinità #miti #leggende #notte #tenebre #oscurità #silenzio #paura #credenze #education #culture #like4likes #like4follow #instalike #indtamood #instaphoto #instapicture #instagood #f4f #colorful #edm #edit #goodnight
Vi auguriamo la buonanotte con un nostro ultimo post. Ecco Erebo, divinità ancestrale; è una figura presente nei miti della religione greca ed è anche conosciuto come il Dio dell'oscurità. È considerato una divinità primordiale in quanto nacque dall'unione tra le Tenebre e il CAOS e dal momento che non esisteva ancora né la LUNA né il SOLE, i genitori procrearono anche il Giorno e la NOTTE. Dato che è la personificazione dell'oscurità, con il termine Erebo si possono indicare anche gli INFERI. Fu una divinità particolarmente prolifica, infatti dalla sua unione con sua sorella Notte nacquero il Fato, l'Aria, la Vecchiaia, la Morte, l'Assassinio, la Continenza, il Sonno, i Sogni, la Discordia, la Miseria, l'Ira, la Nemesi, la Gioia, l'Amicizia, la Pietà, le tre Esperidi, Caronte e le tre MOIRE: Cloti, Lachesi e Atropo #divinità  #miti  #leggende  #notte  #tenebre  #oscurità  #silenzio  #paura  #credenze  #education  #culture  #like4likes  #like4follow  #instalike  #indtamood  #instaphoto  #instapicture  #instagood  #f4f  #colorful  #edm  #edit  #goodnight 
Ognuno ha il diritto di dire, ognuno quello di non ascoltare.
😴😴😴😴 #tizianoferro rro
#buonanotte #goodnight #instasmile #instanight #sweetdreams #ombre #penombra #buio #tenebre #liberta #emozioni
“Balliamo sotto le stelle
Tatuaggi sopra la pelle
Non voglio parlare delle mie paure
Ho paura a parlare di quelle”
#italy #italiangirl #tenebre #sing #love #totalblack #rome #september
"Parfois, je me lève le matin, tout va comme il faut, je vais bien, c’est une belle journée, et y’a cette... Noirceur qui s’immisce et je contrôle plus rien. On dirait un fou qui parle.
J’en suis peut être un. Non... Je ne le crois pas une seconde. Je suis juste une espèce nouvelle. Je ne suis pas plus une bête...." Bref.... Rdv dimanche pour la dernière de la saison 😉 #lacheezy #picoftheday #cloudporn #bulls #chigacobulls #picture #photography #photographer 📸 @instazahreh ✌🏾 #tenebre #grandpalais #quotes #word
"Parfois, je me lève le matin, tout va comme il faut, je vais bien, c’est une belle journée, et y’a cette... Noirceur qui s’immisce et je contrôle plus rien. On dirait un fou qui parle. J’en suis peut être un. Non... Je ne le crois pas une seconde. Je suis juste une espèce nouvelle. Je ne suis pas plus une bête...." Bref.... Rdv dimanche pour la dernière de la saison 😉 #lacheezy  #picoftheday  #cloudporn  #bulls  #chigacobulls  #picture  #photography  #photographer  📸 @instazahreh ✌🏾 #tenebre  #grandpalais  #quotes  #word 
Tenebre (1982) dvd #tenebre
Un superbe moment en randonnée en #auvergne
J'aime ce temps, entre soleil et gros orage
D'ailleurs comme vous pourrez le remarqué il y a un début d'arc en ciel... 🌈😊👌 Vous l'avez trouvé ?
#dog #photography#nature #passion #auvergne #aventure#exploration #nikon #photo #photography #ciel #tenebre #tenebreux #orange #soleil #arcenciel #chien #randonnée #wab #marche #libre
Tenebre, 1982. Another Argento masterpiece. So many bloody death scenes that go on just about five times as long as you’d expect, in the best way possible. So creative, such great music, color, settings (love the mid century modern home). Always appreciate a John Saxon appearance (long time fan of his work, shout out to 1980s Dynasty character Rashid Ahmed). 🔪🔪🔪👠👠👠👝👝👝🚓🚓🚓#tenebre #argento #darioargento #scarymovies #horror #horrormovies #modernartdeath #rashidahmed #johnsaxon #midcenturymodernhorror #dynasty
Tenebre, 1982. Another Argento masterpiece. So many bloody death scenes that go on just about five times as long as you’d expect, in the best way possible. So creative, such great music, color, settings (love the mid century modern home). Always appreciate a John Saxon appearance (long time fan of his work, shout out to 1980s Dynasty character Rashid Ahmed). 🔪🔪🔪👠👠👠👝👝👝🚓🚓🚓#tenebre  #argento  #darioargento  #scarymovies  #horror  #horrormovies  #modernartdeath  #rashidahmed  #johnsaxon  #midcenturymodernhorror  #dynasty 
La #luce splende nelle #tenebre 
Non ci sono tenebre che possano spegnere la luce.
#luce #gioiavivente #vita
#tenebre #tristezza #nonvita
Buona domenica sera #lettori .🐺
Questa per l'iniziativa #alfabetoletterario di @leggifralerighe è stata la settimana della "i" e quindi ho deciso di fotografare "#ilprincipedelletenebre " di @mark___lawrence . Questa è una #serie di cui non è mai uscita la continuazione dopo il primo #libro in italiano..😪 L'ho comprato perché il #titolo mi attirava come una calamita.. Una #frase con "#principe " e "#tenebre " non può mai passare inosservata. Giusto?
#qotd : avete un libro che avete comprato solo perché il #titolo vi attirava? 
#booklife #bookquotes #book #booklover #books #booksnerd #bookstagram #bookslover #booknerd #bookandbed #readingtime #read  #readers #reader #readbooks #bookporn #libridaleggere #leggeretraamici #libri #librifantasy
Buona domenica sera #lettori  .🐺 Questa per l'iniziativa #alfabetoletterario  di @leggifralerighe è stata la settimana della "i" e quindi ho deciso di fotografare "#ilprincipedelletenebre  " di @mark___lawrence . Questa è una #serie  di cui non è mai uscita la continuazione dopo il primo #libro  in italiano..😪 L'ho comprato perché il #titolo  mi attirava come una calamita.. Una #frase  con "#principe  " e "#tenebre  " non può mai passare inosservata. Giusto? #qotd  : avete un libro che avete comprato solo perché il #titolo  vi attirava? #booklife  #bookquotes  #book  #booklover  #books  #booksnerd  #bookstagram  #bookslover  #booknerd  #bookandbed  #readingtime  #read  #readers  #reader  #readbooks  #bookporn  #libridaleggere  #leggeretraamici  #libri  #librifantasy 
Camminando di prima mattina nella nebbia del cimitero di père Lachaise qualche anno fa avevo trovato nella terra, molto semplice, la tomba di Gertrude Stein. C’era un foglietto a quadretti scritto a matita da un anonimo visitatore, fermato da una piccola pietra. Riesco a interpretare alcune parole tra le gocce di pioggia: «Grazie a te Gertrude per aver illuminato la via della letteratura in un periodo di tenebre».
Forse le tenebre stanno tornando.

#Stein #gertrudestein #perelachaise #tenebre.
Camminando di prima mattina nella nebbia del cimitero di père Lachaise qualche anno fa avevo trovato nella terra, molto semplice, la tomba di Gertrude Stein. C’era un foglietto a quadretti scritto a matita da un anonimo visitatore, fermato da una piccola pietra. Riesco a interpretare alcune parole tra le gocce di pioggia: «Grazie a te Gertrude per aver illuminato la via della letteratura in un periodo di tenebre». Forse le tenebre stanno tornando. #Stein  #gertrudestein  #perelachaise  #tenebre .
The other day I saw Dario Argento's infamous #giallo Tenebre (1982), and I wanna jot down a few thoughts.
SPOILER ALERT
.
Peter Neal, an american horror author, is in Rome to promote his latest book, when a serial killer, obviously inspired by Neal's work, starts killing random women. As both local police and Neal himself try to unravel the mystery, the suspects become fewer, as people increasingly closer to Neal become victims.
.
I'm not entirely sure what to make of this movie. On one hand, the acting is quite stilted, there are major gaps in logic, ranging from plot holes to character mistakes, and Argento definitely premieres style over substance.
.
On the other hand, the stylized part of the movie is quite engrossing. The setting is modern and artifical, as no famous landmarks of Rome are utilized (Argento claims the movie takes place in a near future, after an atomic blast), imagery of doubles, copies and mirroring visuals are abundant, and the gore becomes increasingly violent and intense, until the all out crescendo of the climax.
.
As mentioned, dual imagery is a recurring motif in the movie, most prominently by the fact that there are two killers; one original and one copycat. This theme of simulacra pervades the film, since the movie depicts a murder inspiring an author to write about murder inspiring a serial killer to commit murder inspiring the author to commit murder, which makes this movie sort of a comment on how life imitates art and vice versa, seemingly in a chicken-or-egg kind of cycle. It's quite fascinating.
.
Argento, for once, also addresses misogyny in this film. A bit tongue in cheek, maybe, but separating fact from fiction - no matter the resemblance - ties in with the theme of artificiality, and Argento does have fun, throwing in some ambiguous curve balls.
.
All in all, not the masterpiece I was expecting, but definitely interesting.
Highlights: the technicality of the famous 2 minute crane shot and the tension of the murder scene in the public square.
.
#filmcollector #filmnerd #filmaddict #moviegeek #films #movies #horror #horrorfilm #skräck #skräckfilm #horrorclassic #moviereview #darioargento #tenebre #tenebrae
The other day I saw Dario Argento's infamous #giallo  Tenebre (1982), and I wanna jot down a few thoughts. SPOILER ALERT . Peter Neal, an american horror author, is in Rome to promote his latest book, when a serial killer, obviously inspired by Neal's work, starts killing random women. As both local police and Neal himself try to unravel the mystery, the suspects become fewer, as people increasingly closer to Neal become victims. . I'm not entirely sure what to make of this movie. On one hand, the acting is quite stilted, there are major gaps in logic, ranging from plot holes to character mistakes, and Argento definitely premieres style over substance. . On the other hand, the stylized part of the movie is quite engrossing. The setting is modern and artifical, as no famous landmarks of Rome are utilized (Argento claims the movie takes place in a near future, after an atomic blast), imagery of doubles, copies and mirroring visuals are abundant, and the gore becomes increasingly violent and intense, until the all out crescendo of the climax. . As mentioned, dual imagery is a recurring motif in the movie, most prominently by the fact that there are two killers; one original and one copycat. This theme of simulacra pervades the film, since the movie depicts a murder inspiring an author to write about murder inspiring a serial killer to commit murder inspiring the author to commit murder, which makes this movie sort of a comment on how life imitates art and vice versa, seemingly in a chicken-or-egg kind of cycle. It's quite fascinating. . Argento, for once, also addresses misogyny in this film. A bit tongue in cheek, maybe, but separating fact from fiction - no matter the resemblance - ties in with the theme of artificiality, and Argento does have fun, throwing in some ambiguous curve balls. . All in all, not the masterpiece I was expecting, but definitely interesting. Highlights: the technicality of the famous 2 minute crane shot and the tension of the murder scene in the public square. . #filmcollector  #filmnerd  #filmaddict  #moviegeek  #films  #movies  #horror  #horrorfilm  #skräck  #skräckfilm  #horrorclassic  #moviereview  #darioargento  #tenebre  #tenebrae 
“Alcune mie giornate sono spesso albe prolungate... altre sono lunghe notti senza stelle... tempeste senza riparo.... “
#giornatacosì #domenica #tenebre
“Alcune mie giornate sono spesso albe prolungate... altre sono lunghe notti senza stelle... tempeste senza riparo.... “ #giornatacosì  #domenica  #tenebre 
Ma quanto cazzo li shippo. -

#qotd:Shippate Mei e Sakakibara?
#aotd:TROPPO. -

#another #meimisaki #misakifujioka #kouichisakakibara #black #kill #tenebre #morte #buio #verde #rosso #sangue #fateattenzioneagliombrelli #ombrellorosso #uccidere
Weee :D.
Sì, lo so che another non c'entra con aot, ma: 1)Avevo voglia di postarlo. 2)La page è mia. -

#qotd:Vi piace another? :D
#aotd:LO AMO BFDGFFYRSCVKAKAKAKAKAMAKATTTWMGGGRY -

#another #meimisaki #misakifujioka #kouichisakakibara #black #kill #tenebre #morte #buio #verde #rosso #sangue #fateattenzioneagliombrelli #ombrellorosso #uccidere
Demo

Sdraiato nel letto il silenzio assordante la pastiglia sul comodino come calmante. demo che mi sta vicino, l'unico che non se ne ancora andato,mi penetra nella testa come una canzone mi fa venire sempre più motivazioni per il suicidio. ma demo è attaccato alle devozioni delle mie crisi, le paranoie in primis, a farmi venire i dubbi nella notte, a riempirmi di pensieri come botte è bravo. lui è l'unico che riesce a cambiarmi, le persone sono ancora alle prime armi, mentre lui c'è da quando eh da quando ho iniziato a tenere tutto dentro; per le parole che subivo sempre al centro. messo al muro e da lì ho detto giuro, da qui cambio. poi presi una sedia, un cappio, ma alla fine mollai la presa. incontrai demo e da li restó come un taglio. profondo che si cicatrizza restando un brutto ricordo, che si trasforma in vizio. la gente mi guarda come fossi diverso, un malato pazzo perso tra il dolore assordante, dal rumore delle voci che la notte non fanno,non mi fanno dormire
Demo e bipolare. a volte mi fa male mi fa impazzire e quando la voglio finire qui, lui me lo impedisce sparisce, torna con un carico di pensieri pronti a distruggermi. a seppellirmi tra le fiamme del inferno, bruciando al Interno. combustionando tutto ciò che ho dentro, sminuendosi come cenere sbuffo le tenebre dopo tutto quello che ho da tenere nella testa. Sto per cedere in un cratere profondo come le fossette di venere. demo e tutto ciò che mi resta, è lui che mi causa la tempesta anche con fuori il sole.

#sadness #depression #sfogo #testo #tumblr #demons #cratere #fossette #cenere #venere #testa #inferno #tenebre
Demo Sdraiato nel letto il silenzio assordante la pastiglia sul comodino come calmante. demo che mi sta vicino, l'unico che non se ne ancora andato,mi penetra nella testa come una canzone mi fa venire sempre più motivazioni per il suicidio. ma demo è attaccato alle devozioni delle mie crisi, le paranoie in primis, a farmi venire i dubbi nella notte, a riempirmi di pensieri come botte è bravo. lui è l'unico che riesce a cambiarmi, le persone sono ancora alle prime armi, mentre lui c'è da quando eh da quando ho iniziato a tenere tutto dentro; per le parole che subivo sempre al centro. messo al muro e da lì ho detto giuro, da qui cambio. poi presi una sedia, un cappio, ma alla fine mollai la presa. incontrai demo e da li restó come un taglio. profondo che si cicatrizza restando un brutto ricordo, che si trasforma in vizio. la gente mi guarda come fossi diverso, un malato pazzo perso tra il dolore assordante, dal rumore delle voci che la notte non fanno,non mi fanno dormire Demo e bipolare. a volte mi fa male mi fa impazzire e quando la voglio finire qui, lui me lo impedisce sparisce, torna con un carico di pensieri pronti a distruggermi. a seppellirmi tra le fiamme del inferno, bruciando al Interno. combustionando tutto ciò che ho dentro, sminuendosi come cenere sbuffo le tenebre dopo tutto quello che ho da tenere nella testa. Sto per cedere in un cratere profondo come le fossette di venere. demo e tutto ciò che mi resta, è lui che mi causa la tempesta anche con fuori il sole. #sadness  #depression  #sfogo  #testo  #tumblr  #demons  #cratere  #fossette  #cenere  #venere  #testa  #inferno  #tenebre 
Questa io la chiamo idealità: vedere un’aurora là dove viene accesa una candela!
Friedrich Nietzsche
.
.
#candela #candles #candlelight #dark #night #frasedelgiorno #details #details✨ #luce #buio #buioeluce #detailphotography #nightphotoshoot #nightphotography #candele #nietzsche #quote #positivethinking #tenebre #detailhunters #detaillover  #lovephotography #instaphoto #instalights #picofthenight🌙 #🕯
este es mi trabajo para escultura, sin terminar. teníamos que elegir una obra de arte latinoamericana. yo elegí este fantasma de leonora carrington, inglesa nacionalizada mexicana. fue una increíble pintora surrealista sumergida en su propio universo -fue paciente psiquiátrica-, pero la historia oficial apenas nos la presenta como la esposa de max ernst.

#arcilla #clay #ghost #leonoracarrington #escultura #scupulture #art #instart #escuelamanuelbelgrano #picoftheday #fantasma #naif #tenebre #obscuro
este es mi trabajo para escultura, sin terminar. teníamos que elegir una obra de arte latinoamericana. yo elegí este fantasma de leonora carrington, inglesa nacionalizada mexicana. fue una increíble pintora surrealista sumergida en su propio universo -fue paciente psiquiátrica-, pero la historia oficial apenas nos la presenta como la esposa de max ernst. #arcilla  #clay  #ghost  #leonoracarrington  #escultura  #scupulture  #art  #instart  #escuelamanuelbelgrano  #picoftheday  #fantasma  #naif  #tenebre  #obscuro 
Earlier this evening I went by the movie club Cinemateket at the Swedish Film Institute with a friend to watch Dario Argento's iconic #giallo Tenebre (1982), a gore fest banned in several countries and censored in several  other, showcased in a theater named after swedish director Victor Sjöström, who directed the old silent horror classic The Phantom Carriage (Körkarlen, 1921).
.
The vast tapestry of horror comes together full circle...
.
#filmcollector #filmnerd #filmaddict #moviegeek #films #movies #horrorfilm #horror #skräck #skräckfilm #cinema #tenebre #tenebrae #darioargento
Earlier this evening I went by the movie club Cinemateket at the Swedish Film Institute with a friend to watch Dario Argento's iconic #giallo  Tenebre (1982), a gore fest banned in several countries and censored in several other, showcased in a theater named after swedish director Victor Sjöström, who directed the old silent horror classic The Phantom Carriage (Körkarlen, 1921). . The vast tapestry of horror comes together full circle... . #filmcollector  #filmnerd  #filmaddict  #moviegeek  #films  #movies  #horrorfilm  #horror  #skräck  #skräckfilm  #cinema  #tenebre  #tenebrae  #darioargento 
Commande recu , toujours prozis 💪😋 en complément pour le sport comme pour la diet hésitait pas à faire un tour sur le site Prozis et avec mon code "ZAMER" vous aurez des cadeaux 🎁 et - 10 % sur vos commandes.
#PROZIS
#prozisfrance
#qlf #peace
#sombre #tenebre #Samuraï #tarzanmode #sec
#prozisfrance #hammerz #zamer #secretdelacier #pnl #paris  #musculation #pnlnos #france #fitfrench #sheita  #nda #fitnesslifestyle #playa #monkey #muscle #shredded #dz #workout  #instafitness
Commande recu , toujours prozis 💪😋 en complément pour le sport comme pour la diet hésitait pas à faire un tour sur le site Prozis et avec mon code "ZAMER" vous aurez des cadeaux 🎁 et - 10 % sur vos commandes. #PROZIS  #prozisfrance  #qlf  #peace  #sombre  #tenebre  #Samuraï  #tarzanmode  #sec  #prozisfrance  #hammerz  #zamer  #secretdelacier  #pnl  #paris  #musculation  #pnlnos  #france  #fitfrench  #sheita  #nda  #fitnesslifestyle  #playa  #monkey  #muscle  #shredded  #dz  #workout  #instafitness 
Salut peuple de la terre, 
Aujourd’hui une photo prise pendant la nuit! Ça ne m’arrive pas tout le temps mais je trouvais l’angle trop jolis! Je sais, je sais, je m’extase devant une bougie mais honnêtement elle est jolie non? Hahha 
Bon je vous laisse profiter de votre soirée et passez un un excellent week-end ☺️ #vie #lifestyle #bougie #chambre #rouge #lit #nuit #photography #picoftheday #pictureoftheday #love #nightmare #cauchemar #composition #lumiere #candle #light #darkness #tenebre #vide #void #joie #happy #swiss #suisse #switzerland #french
Salut peuple de la terre, Aujourd’hui une photo prise pendant la nuit! Ça ne m’arrive pas tout le temps mais je trouvais l’angle trop jolis! Je sais, je sais, je m’extase devant une bougie mais honnêtement elle est jolie non? Hahha Bon je vous laisse profiter de votre soirée et passez un un excellent week-end ☺️ #vie  #lifestyle  #bougie  #chambre  #rouge  #lit  #nuit  #photography  #picoftheday  #pictureoftheday  #love  #nightmare  #cauchemar  #composition  #lumiere  #candle  #light  #darkness  #tenebre  #vide  #void  #joie  #happy  #swiss  #suisse  #switzerland  #french 
Puoi trovarmi nelle cose che non troverai
Puoi ascoltarmi nel ricordo di quello che sei
Puoi lasciare i tuoi saluti qui in segreteria
Tu che sei parte di tutto ma senza esser mia
E tra le cose che scrivo ho trovato un motivo
Scusa sono indeciso in queste sere..
Ma per sentirmi vivo
Ne ho bisogno, ti scrivo
Lascia un posto per me tra le tue tenebre! #ultimo #tenebre #rapsempreconme @ultimopeterpan
Puoi trovarmi nelle cose che non troverai Puoi ascoltarmi nel ricordo di quello che sei Puoi lasciare i tuoi saluti qui in segreteria Tu che sei parte di tutto ma senza esser mia E tra le cose che scrivo ho trovato un motivo Scusa sono indeciso in queste sere.. Ma per sentirmi vivo Ne ho bisogno, ti scrivo Lascia un posto per me tra le tue tenebre! #ultimo  #tenebre  #rapsempreconme  @ultimopeterpan
Fuori ora su YouTube il video ufficiale di ‘Cascare nei tuoi occhi’
E A VOI È PIACIUTO IL VIDEO?
_________________________________
@ultimopeterpan 
#PeterPanLiveTour #ultimo #pianeti #ilballodelleincertezze #leleganzadellestelle #lunicaforzacheho #lastellapiùfragiledelluniverso #giusy #ovunquetusia #racconteròdite #concerto #roma #milano #milleuniversi #canzonestupida #capolavoro #chiave #honiro #honirolabel #honirostore #sanremogiovani #sanremo2018 #sabbia #sogniappesi #tenebre
Fuori ora su YouTube il video ufficiale di ‘Cascare nei tuoi occhi’ E A VOI È PIACIUTO IL VIDEO? _________________________________ @ultimopeterpan #PeterPanLiveTour  #ultimo  #pianeti  #ilballodelleincertezze  #leleganzadellestelle  #lunicaforzacheho  #lastellapiùfragiledelluniverso  #giusy  #ovunquetusia  #racconteròdite  #concerto  #roma  #milano  #milleuniversi  #canzonestupida  #capolavoro  #chiave  #honiro  #honirolabel  #honirostore  #sanremogiovani  #sanremo2018  #sabbia  #sogniappesi  #tenebre 
It’s close to midnight...Something evil’s lurking from the dark! 😈 #thriller #selfie #michaeljackson #noir #tenebre #darioargento #antoniettalaterza #sirenacyborg #notte #sexy #blonde #suspense #ASMSG #songwriter #italy #Bologna
🔖Si tu devais choisir un mot pour décrire ce que t’inspire cette photo❓ 💆🏽‍♀️🧚🏽‍♂️ —————————🤷🏽‍♀️ If you had to choose a word to describe what inspires you this pic🧚🏼‍♀️——————————————————————————— Lieu 📍#ruedelarepublique #toulousecity—————————————————————————- Paysage 🍀 #coucherdusoleil—————————————————————————Photo lifestyle 📸🧚🏽‍♂️ #amiraso 🖼 ———————————————————————————#paysageurbain #urbainart
🔖Si tu devais choisir un mot pour décrire ce que t’inspire cette photo❓ 💆🏽‍♀️🧚🏽‍♂️ —————————🤷🏽‍♀️ If you had to choose a word to describe what inspires you this pic🧚🏼‍♀️——————————————————————————— Lieu 📍#ruedelarepublique  #toulousecity —————————————————————————- Paysage 🍀 #coucherdusoleil —————————————————————————Photo lifestyle 📸🧚🏽‍♂️ #amiraso  🖼 ———————————————————————————#paysageurbain  #urbainart