an online Instagram web viewer

#saglikliyasiyoruz medias

Photos

Denizler ve deniz canlilari da malesef insanoglunun acimasiz, cilgin boyutlardaki tuketiminden ve cevre kirliliginden nasibini almis durumda. Haliyle saglikli, dogal/deniz baligi bulmak da zor artik. O yuzden balik konusunda da hepimizin kafasi karisiyor. Hangi balik sagliklidir, hangi baliklari yemeliyiz? Gerci bu biraz da yasadiginiz yere bagli.! Her zaman bulundugunuz bolgede yetisen gidalar, canlilar daha dogal ve taze olacaktir. Yediklerimizin bulundugumuz yerde mevsimlerini de iyi bilirsek o zaman bircok riskin de onune gecmis oluyoruz. Benim de severek takip ettigim @saglikliyasiyoruzcom grubu cok guzel bilgiler paylasmanin yaninda mevsim meyveleri, baliklari hk duzenli olarak guzel bir rehber liste yayinliyor, haberiniz olsun! .........
.
Dr. Hyman’in balik hk goruslerini onemli basliklar olarak su sekilde sizler icin ozetledim:
🐟Omega-3 /DHA, EPA kaynagi yagli baliklar kalp sagligi icin cok onemli. Kalp krizi ve yuksek tansiyon riskini azaltiyor,
🐟Tip 2 Diyabet, Romatizma ve Otoimmun Hastaliklar ve Depresyon tedavisinde cok etkili,
🐟Saglikli bir beden icin Omega-3 ve Omega-6 tuketimi dengeli olmali (1:1)
🐟Ciftlik Somonu saglik icin sakincali. Tahilla beslendikleri icin Omega-6 icerikleri yuksek, enflamasyona ve diyabete onculuk ediyor,
🐟Kucuk baliklar en iyisi !! Koyu renkli, yagli ve keskin tadi olan baliklar en kiymetlileri*** orn. Sardalya, Uskumru, Hamsi ve Deniz Somonu (Wild Alaskan),
🐟Saglik icin haftada 2 defa balik tuketilmeli. Bebeklerin beyin gelisimi icin hamileler daha cok omega-3 iceren balik veya takviyesi tuketmeli.
🐟Konserve balik ok! Konserve baligin su icinde olani degil, yag icinde olani iyi cunku yag besinleri koruyor. Ayrica kucuk baliklarin kalsiyum acisindan yuksek olan kemiklerini de yumusattigi icin yenilebilir yapiyor,
🐟Sushi saglikli bir yiyecek degildir! Hem cok yuksek civa iceren Tuna* hem de baliktan cok nisasta ve rafine pirinc icerir,
🐟Ceviz, keten tohumu gibi bitkisel/vegan Omega-3 secenekler de balik kadar etkili olmasa da vucutta DHA, EPA’ya donusen ALA icerir.
🐟Krill (plankton) civa ve dioxin acisindan dusuk, yuksek DHA, EPA icerir,
🐟Su Yosunu (Algae) beyin icin onemli bir kaynak olan DHA Icerir... (english 👇)
Denizler ve deniz canlilari da malesef insanoglunun acimasiz, cilgin boyutlardaki tuketiminden ve cevre kirliliginden nasibini almis durumda. Haliyle saglikli, dogal/deniz baligi bulmak da zor artik. O yuzden balik konusunda da hepimizin kafasi karisiyor. Hangi balik sagliklidir, hangi baliklari yemeliyiz? Gerci bu biraz da yasadiginiz yere bagli.! Her zaman bulundugunuz bolgede yetisen gidalar, canlilar daha dogal ve taze olacaktir. Yediklerimizin bulundugumuz yerde mevsimlerini de iyi bilirsek o zaman bircok riskin de onune gecmis oluyoruz. Benim de severek takip ettigim @saglikliyasiyoruzcom grubu cok guzel bilgiler paylasmanin yaninda mevsim meyveleri, baliklari hk duzenli olarak guzel bir rehber liste yayinliyor, haberiniz olsun! ......... . Dr. Hyman’in balik hk goruslerini onemli basliklar olarak su sekilde sizler icin ozetledim: 🐟Omega-3 /DHA, EPA kaynagi yagli baliklar kalp sagligi icin cok onemli. Kalp krizi ve yuksek tansiyon riskini azaltiyor, 🐟Tip 2 Diyabet, Romatizma ve Otoimmun Hastaliklar ve Depresyon tedavisinde cok etkili, 🐟Saglikli bir beden icin Omega-3 ve Omega-6 tuketimi dengeli olmali (1:1) 🐟Ciftlik Somonu saglik icin sakincali. Tahilla beslendikleri icin Omega-6 icerikleri yuksek, enflamasyona ve diyabete onculuk ediyor, 🐟Kucuk baliklar en iyisi !! Koyu renkli, yagli ve keskin tadi olan baliklar en kiymetlileri*** orn. Sardalya, Uskumru, Hamsi ve Deniz Somonu (Wild Alaskan), 🐟Saglik icin haftada 2 defa balik tuketilmeli. Bebeklerin beyin gelisimi icin hamileler daha cok omega-3 iceren balik veya takviyesi tuketmeli. 🐟Konserve balik ok! Konserve baligin su icinde olani degil, yag icinde olani iyi cunku yag besinleri koruyor. Ayrica kucuk baliklarin kalsiyum acisindan yuksek olan kemiklerini de yumusattigi icin yenilebilir yapiyor, 🐟Sushi saglikli bir yiyecek degildir! Hem cok yuksek civa iceren Tuna* hem de baliktan cok nisasta ve rafine pirinc icerir, 🐟Ceviz, keten tohumu gibi bitkisel/vegan Omega-3 secenekler de balik kadar etkili olmasa da vucutta DHA, EPA’ya donusen ALA icerir. 🐟Krill (plankton) civa ve dioxin acisindan dusuk, yuksek DHA, EPA icerir, 🐟Su Yosunu (Algae) beyin icin onemli bir kaynak olan DHA Icerir... (english 👇)
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
Eve gelir gelmezzz misss gibi bir koku evi sarmış annem bahçeden 🌽 mısır koparmış ve düdüklü de pişiriyordu.
Akşam yemeğine de bahçeden taze fasulye yapmış.
Buzlukta Dere Balığı vardı onu da çıkarmış.
Hemen üzerimi değişip mutfağa attım kendimi.
6 tane dilim çıktı poşetten 1 tanesini ben kendime Tost Makinesinde yağlı kağıt ile pişirdim.
Annem geri kalanını mısır unu soğan sarımsak ve Baharatlara bulayıp tavada bol yağda pişirdi 😂
Ve itiraf ediyorum aç gözlü olan ben kendi tabağımı silip süpürdükten sonra annemlerin balığından yedim herkese 1 er dilim düşüyor  ve ortada 1 tane  fazlalık kalıyordu.Ablalarımdan biri kendi hakkını yemeyincd onunkini yedim ortada kalan dilimide kimse yemeyince annemle bölüştük 🙊
Üzerine bir sürü 🍉 karpuz ve kırmızı erik yedim 💃
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşik Biber,2 adet Yeşil Biber+Zeytin)
.Dere Balığı
.Taze Fasulye Yemeği
.Karpuz ve Erik
.
#aksamyemegi#dinner#saglik#balık#derebalığı#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#omega3#tazefasulye#ızgarabalık#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#salata#karpuz#sagliklibesleniyoruz#balıketi#beforeafter#fish
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 Eve gelir gelmezzz misss gibi bir koku evi sarmış annem bahçeden 🌽 mısır koparmış ve düdüklü de pişiriyordu. Akşam yemeğine de bahçeden taze fasulye yapmış. Buzlukta Dere Balığı vardı onu da çıkarmış. Hemen üzerimi değişip mutfağa attım kendimi. 6 tane dilim çıktı poşetten 1 tanesini ben kendime Tost Makinesinde yağlı kağıt ile pişirdim. Annem geri kalanını mısır unu soğan sarımsak ve Baharatlara bulayıp tavada bol yağda pişirdi 😂 Ve itiraf ediyorum aç gözlü olan ben kendi tabağımı silip süpürdükten sonra annemlerin balığından yedim herkese 1 er dilim düşüyor ve ortada 1 tane fazlalık kalıyordu.Ablalarımdan biri kendi hakkını yemeyincd onunkini yedim ortada kalan dilimide kimse yemeyince annemle bölüştük 🙊 Üzerine bir sürü 🍉 karpuz ve kırmızı erik yedim 💃 . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşik Biber,2 adet Yeşil Biber+Zeytin) .Dere Balığı .Taze Fasulye Yemeği .Karpuz ve Erik . #aksamyemegi #dinner #saglik #balık #derebalığı #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #omega3 #tazefasulye #ızgarabalık #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #salata #karpuz #sagliklibesleniyoruz #balıketi #beforeafter #fish 
BiZim çiftlikte her iş neşeyle yapılır😀, sevgi katılır😍❤️ve çok lezzetli olur. Kışa hazırlık için🥤🍹
#nofilter #ciftlikteyasamak #çiftlik #farm #horse #atciftligi #healty #healtyfood #kışahazırlık #erik #erikdalı #mutluluk #neşe #goodfood #saglikliyasiyoruz #happy
SAÇKIRAN ● Vazelin ile sarısabır (aloevera) merhem yapılıp saç dökülen bölgeye uygulanır
● sirke ruhu 10 ar gün ara ile bir defa sürülür ● soğan suyu zeytinyağı karışımı uygulanır ● sarımsağin iç kısmı ince tuza batirilarak bölge iyice ovulur ve her gün uygulanır
● sedef otu ve sarimsak yakılır, külleri zeytinyağı ile karıştırılıp sorunlu bölgeye uygulanır
《Şifayı veren Allah'tır.》
#sackiran #aloevera #sarisabir #sarımsak 
#instasaglik #instamoment #instagram #saglikliyasiyoruz #sifadogada #sifalibitkiler #herbalhealing #naturalhealing #naturalhealthcare #sifalibitkiler #bitkilerletedavi
SAÇKIRAN ● Vazelin ile sarısabır (aloevera) merhem yapılıp saç dökülen bölgeye uygulanır ● sirke ruhu 10 ar gün ara ile bir defa sürülür ● soğan suyu zeytinyağı karışımı uygulanır ● sarımsağin iç kısmı ince tuza batirilarak bölge iyice ovulur ve her gün uygulanır ● sedef otu ve sarimsak yakılır, külleri zeytinyağı ile karıştırılıp sorunlu bölgeye uygulanır 《Şifayı veren Allah'tır.》 #sackiran  #aloevera  #sarisabir  #sarımsak  #instasaglik  #instamoment  #instagram  #saglikliyasiyoruz  #sifadogada  #sifalibitkiler  #herbalhealing  #naturalhealing  #naturalhealthcare  #sifalibitkiler  #bitkilerletedavi 
SUSAM ve TAHİN
● Susam  25 gr  Bal  25 gr 
Birbirine karıştırıp gün içinde  bir kaç defa tüketilmesi kilo aldırır.
Damarları açar.
Göğüs sertliğini giderir.
Sesi güzelleştirir.
Böbrek iltihaplarını giderir.
● Tahin ise böbreklerin en önemli ilaçlarından biridir, enfeksiyon temizler.
《Şifayı veren Allah'tır.》
#susam #sesame #instasaglik #instamoment #instagram #saglikliyasiyoruz #naturalhealing #naturalhealthcare #sifadogada #sifalibitkiler #bitkilerletedavi #herbalhealing
SUSAM ve TAHİN ● Susam 25 gr Bal 25 gr Birbirine karıştırıp gün içinde bir kaç defa tüketilmesi kilo aldırır. Damarları açar. Göğüs sertliğini giderir. Sesi güzelleştirir. Böbrek iltihaplarını giderir. ● Tahin ise böbreklerin en önemli ilaçlarından biridir, enfeksiyon temizler. 《Şifayı veren Allah'tır.》 #susam  #sesame  #instasaglik  #instamoment  #instagram  #saglikliyasiyoruz  #naturalhealing  #naturalhealthcare  #sifadogada  #sifalibitkiler  #bitkilerletedavi  #herbalhealing 
Dökümü yapılan ilk parti sahanların egosunu dizginlemek ve demirin sıcaklığını silkelenip üzerlerinden atsınlar diye ilk günden mesajı verdik.4kardeş olduğunuza güvenmeyin sizden büyük 26cm tava var dedik😂Peki dediler delikanlı olup,kırılıp/incinmediklerini uçarak kanıtladılar,siz de şahit olun efem😂😂😂😎(FİYATLAR HENÜZ BELLİ DEĞİLDİR)
SATIŞTAN ÖNCELİKLİ HABERDAR OLMAK  İÇİN E-MAİL ADRESİNİZİ DM ATABİLİRSİNİZ,DUYURU LİSTESİNE EKLENECEK🐻💗🍳😀👍.Ham Döküm ürünler hakkında daha bi sürü şey icin👉youtube:dokumcubaba 👉DOKUMCUBABA.COM #dökümsahan #blackandbear #dökümcübaba #dokumcubaba #food  #instafood #dinner #eating #castiron #foodpic #foodporn#foodie  #dökümtava #turkishfood #mutfakgram #outdoor #camping #bushcraftturkiye #bushcraft #kampvedogahayati #dökümtavacandir #dokumtava #canankaratay #saglikliyasam #saglikliyasiyoruz  #bearfood #bear #ayi #ayı
Dökümü yapılan ilk parti sahanların egosunu dizginlemek ve demirin sıcaklığını silkelenip üzerlerinden atsınlar diye ilk günden mesajı verdik.4kardeş olduğunuza güvenmeyin sizden büyük 26cm tava var dedik😂Peki dediler delikanlı olup,kırılıp/incinmediklerini uçarak kanıtladılar,siz de şahit olun efem😂😂😂😎(FİYATLAR HENÜZ BELLİ DEĞİLDİR) SATIŞTAN ÖNCELİKLİ HABERDAR OLMAK İÇİN E-MAİL ADRESİNİZİ DM ATABİLİRSİNİZ,DUYURU LİSTESİNE EKLENECEK🐻💗🍳😀👍.Ham Döküm ürünler hakkında daha bi sürü şey icin👉youtube:dokumcubaba 👉DOKUMCUBABA.COM #dökümsahan  #blackandbear  #dökümcübaba  #dokumcubaba  #food  #instafood  #dinner  #eating  #castiron  #foodpic  #foodporn #foodie  #dökümtava  #turkishfood  #mutfakgram  #outdoor  #camping  #bushcraftturkiye  #bushcraft  #kampvedogahayati  #dökümtavacandir  #dokumtava  #canankaratay  #saglikliyasam  #saglikliyasiyoruz  #bearfood  #bear  #ayi  #ayı 
Doğuştan gelmeyen tek yetenek, istemektir.
Olmak istemek, iyi olmak istemek, daha iyi olmak istemek, en iyi olmak istemek.
Sahip olabileceğin en önemli yetenek budur.
Asıl yetenek budur.
İstersen alırsın, istersen yaparsın, istersen olursun."
Herşey Mümkün OLANAKLI 
Jim Rohn 
#yildizekipyasamklupleri🌟 #yıldızekip #yildizekip👊✌✌ #sağlıklıyaşıyoruz #saglikliyasiyoruz #healtyfoods #herbalife #karsiyakaherbalife #izmirherbalife #herbalifekarşıyaka #karsiyakasaglikliaktifyasamevi #zumabeach #fitness #kiloalmakistiyorum #kilovermekistiyorum #temizbeslen  #ksk #kahvalti #karsiyakakahvalti
Doğuştan gelmeyen tek yetenek, istemektir. Olmak istemek, iyi olmak istemek, daha iyi olmak istemek, en iyi olmak istemek. Sahip olabileceğin en önemli yetenek budur. Asıl yetenek budur. İstersen alırsın, istersen yaparsın, istersen olursun." Herşey Mümkün OLANAKLI Jim Rohn #yildizekipyasamklupleri 🌟 #yıldızekip  #yildizekip 👊✌✌ #sağlıklıyaşıyoruz  #saglikliyasiyoruz  #healtyfoods  #herbalife  #karsiyakaherbalife  #izmirherbalife  #herbalifekarşıyaka  #karsiyakasaglikliaktifyasamevi  #zumabeach  #fitness  #kiloalmakistiyorum  #kilovermekistiyorum  #temizbeslen  #ksk  #kahvalti  #karsiyakakahvalti 
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
Yemeği hazırlarken 2 kepçe Taze Bamya Yemeği yedim.
O kadar güzel olmuş ki böyle vıcık vıcık hani bamya süner ya enfes sünüyordu 🙊
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşik Biber,2 adet Yeşil Biber+Zeytin+Kekik)
. Bamya Yemeği .2 kepçe Soğuk Kırmızı Mercimek Çorbası ( bol acılı)
.250 mL Kefir ( Zerdeçal+Karabiber)
.ilave olarak ablamın bamya yemeğini yedim + üzerine 2 kepçe daha Bamya Yemeği ve 1 kepçe daha Kırmızı Mercimek Çorbası içtim 🙊
.
.
#aksamyemegi#dinner#saglik#bamya#bamyayemeği#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#tazebamya#kırmızımercimek#mercimek#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#mercimekcorbasi#kefir#sagliklibesleniyoruz#kirmizimercimekcorbasi#beforeafter#zerdeçal
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 Yemeği hazırlarken 2 kepçe Taze Bamya Yemeği yedim. O kadar güzel olmuş ki böyle vıcık vıcık hani bamya süner ya enfes sünüyordu 🙊 . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşik Biber,2 adet Yeşil Biber+Zeytin+Kekik) . Bamya Yemeği .2 kepçe Soğuk Kırmızı Mercimek Çorbası ( bol acılı) .250 mL Kefir ( Zerdeçal+Karabiber) .ilave olarak ablamın bamya yemeğini yedim + üzerine 2 kepçe daha Bamya Yemeği ve 1 kepçe daha Kırmızı Mercimek Çorbası içtim 🙊 . . #aksamyemegi #dinner #saglik #bamya #bamyayemeği #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #tazebamya #kırmızımercimek #mercimek #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #mercimekcorbasi #kefir #sagliklibesleniyoruz #kirmizimercimekcorbasi #beforeafter #zerdeçal 
Reflü şikayetleri nelerdir?

Reflü hastalığını düşünmemiz için meydana gelen şikâyetler çok fazla ancak iki tane ana şikâyet özellikle reflüyü düşündürmektedir. Birincisi özellikle kalp hastalıklarına bağlı ağrıyla karışabilen göğüste yanma hissi, burada göğüste yanma hissinde en çok dikkat edilecek şey göğüs kemiğinin alt kısmından başlayıp yukarı doğru yanma şeklinde olması bunu zaman zaman kalp hastalarına bağlı ağrılarla karıştığı için öncelikle kalp hastalarını ayırt etmek lazım ama reflü için oldukça önemli bir belirtidir. Bunun yanında diğer önemli belirtisi reültstasyon dediğimiz ağza acı, ekşi su gelmesi, bu ikisi reflünün ana belli başlı belirtileridir. Ancak bunun dışında kronik öksürük olması, ses kısıklığı olması gibi başka belirtilerde reflüyü düşündürebilmektedir. Yine göğüs ağrısı dışında yutma güçlüğü de aklımıza reflüyü getirebilir.

#sindirimuzmani #tgd #sindirim #mide #gastroenteroloji #gastroenterology  #endoskopi #gastroskopi #midehastaliklari #miderahatsizliklari #ulser #reflü #midekanamasi #yemekborusu #protonpompasi #saglik #yasam #saglikliyaşam #saglikliyasiyoruz #hastalik #tıp #hekim #doktor #uzman #tedavi #instahealth #instagood #like4like #likeforlike #instaturkey
Reflü şikayetleri nelerdir? Reflü hastalığını düşünmemiz için meydana gelen şikâyetler çok fazla ancak iki tane ana şikâyet özellikle reflüyü düşündürmektedir. Birincisi özellikle kalp hastalıklarına bağlı ağrıyla karışabilen göğüste yanma hissi, burada göğüste yanma hissinde en çok dikkat edilecek şey göğüs kemiğinin alt kısmından başlayıp yukarı doğru yanma şeklinde olması bunu zaman zaman kalp hastalarına bağlı ağrılarla karıştığı için öncelikle kalp hastalarını ayırt etmek lazım ama reflü için oldukça önemli bir belirtidir. Bunun yanında diğer önemli belirtisi reültstasyon dediğimiz ağza acı, ekşi su gelmesi, bu ikisi reflünün ana belli başlı belirtileridir. Ancak bunun dışında kronik öksürük olması, ses kısıklığı olması gibi başka belirtilerde reflüyü düşündürebilmektedir. Yine göğüs ağrısı dışında yutma güçlüğü de aklımıza reflüyü getirebilir. #sindirimuzmani  #tgd  #sindirim  #mide  #gastroenteroloji  #gastroenterology  #endoskopi  #gastroskopi  #midehastaliklari  #miderahatsizliklari  #ulser  #reflü  #midekanamasi  #yemekborusu  #protonpompasi  #saglik  #yasam  #saglikliyaşam  #saglikliyasiyoruz  #hastalik  #tıp  #hekim  #doktor  #uzman  #tedavi  #instahealth  #instagood  #like4like  #likeforlike  #instaturkey 
Gelen numune sahanlar boş durmasın,pişirsin diyerekten pişirmelere devam efendim.Künefe paketinde gelen alüminyum kapla(Alüm. Fırında 200-250c de yapısı bozulmaya başlayacak çünkü) ısıtmak istemediğim için,içine cuk oturan 16cm lik minnak sahan da pişirdik,tabi ki efsane oldu😎(FİYATLAR HENÜZ BELLİ DEĞİLDİR)
SATIŞTAN ÖNCELİKLİ HABERDAR OLMAK  İÇİN E-MAİL ADRESİNİZİ DM ATABİLİRSİNİZ,DUYURU LİSTESİNE EKLENECEK🐻💗🍳😀👍.Ham Döküm ürünler hakkında daha bi sürü şey icin👉youtube:dokumcubaba 👉DOKUMCUBABA.COM #dökümsahan #blackandbear #dökümcübaba #dokumcubaba #food  #instafood #dinner #eating #castiron #foodpic #foodporn#foodie  #dökümtava #turkishfood #mutfakgram #outdoor #camping #bushcraftturkiye #bushcraft #kampvedogahayati #dökümtavacandir #dokumtava #canankaratay #saglikliyasam #saglikliyasiyoruz  #bearfood #bear #ayi #ayı #künefe
Gelen numune sahanlar boş durmasın,pişirsin diyerekten pişirmelere devam efendim.Künefe paketinde gelen alüminyum kapla(Alüm. Fırında 200-250c de yapısı bozulmaya başlayacak çünkü) ısıtmak istemediğim için,içine cuk oturan 16cm lik minnak sahan da pişirdik,tabi ki efsane oldu😎(FİYATLAR HENÜZ BELLİ DEĞİLDİR) SATIŞTAN ÖNCELİKLİ HABERDAR OLMAK İÇİN E-MAİL ADRESİNİZİ DM ATABİLİRSİNİZ,DUYURU LİSTESİNE EKLENECEK🐻💗🍳😀👍.Ham Döküm ürünler hakkında daha bi sürü şey icin👉youtube:dokumcubaba 👉DOKUMCUBABA.COM #dökümsahan  #blackandbear  #dökümcübaba  #dokumcubaba  #food  #instafood  #dinner  #eating  #castiron  #foodpic  #foodporn #foodie  #dökümtava  #turkishfood  #mutfakgram  #outdoor  #camping  #bushcraftturkiye  #bushcraft  #kampvedogahayati  #dökümtavacandir  #dokumtava  #canankaratay  #saglikliyasam  #saglikliyasiyoruz  #bearfood  #bear  #ayi  #ayı  #künefe 
Sabah sütlü kahve ve öğlen yeşil fasulye.... ara öğünde kuruyemiş ve yeşil çay 🍵....
Çok paylaşım yapmıyorum ama halaaa sağlıklı besleniyorum, buralardayım.
.
.
.
.
#şekersiz 21gün #diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
Sabah sütlü kahve ve öğlen yeşil fasulye.... ara öğünde kuruyemiş ve yeşil çay 🍵.... Çok paylaşım yapmıyorum ama halaaa sağlıklı besleniyorum, buralardayım. . . . . #şekersiz  21gün #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
Tariffffff 💃💃💃
.
Fırında Hindi Fümeli Mısır Unlu Kabak Mücver '
Kabakları ve Soğanları rendeleyip suyunu sıkıyoruz.
İçerisine Baharatlar ve Yumurta ilave edip karıştırıyoruz isterseniz içine dilediğiniz Peyniri de ilave edebilirsiniz.
Glutensiz olması için Mısır Unu kullandım.
Vee protein olsun diye 4 tane @nametgida
Hindi Füme yi parçaladım ve içine koydum.
Yağlı kağıt serdiğim pasta kabına döktüm.
3.görsel ise annemlere yaptığımda ise sadece mısır unu yerine buğday unu var ve hindi füme yok ..
#tarifler#yemekyemek#saglik#mücver#kabak#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#fitmücver#yeşilkabak#glutensizmücver#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#misirunu#firindamucver#sagliklibesleniyoruz#eat#beforeafter#sagliklitarifler
Tariffffff 💃💃💃 . Fırında Hindi Fümeli Mısır Unlu Kabak Mücver ' Kabakları ve Soğanları rendeleyip suyunu sıkıyoruz. İçerisine Baharatlar ve Yumurta ilave edip karıştırıyoruz isterseniz içine dilediğiniz Peyniri de ilave edebilirsiniz. Glutensiz olması için Mısır Unu kullandım. Vee protein olsun diye 4 tane @nametgida Hindi Füme yi parçaladım ve içine koydum. Yağlı kağıt serdiğim pasta kabına döktüm. 3.görsel ise annemlere yaptığımda ise sadece mısır unu yerine buğday unu var ve hindi füme yok .. #tarifler #yemekyemek #saglik #mücver #kabak #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #fitmücver #yeşilkabak #glutensizmücver #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #misirunu #firindamucver #sagliklibesleniyoruz #eat #beforeafter #sagliklitarifler 
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
Yedikçe yedim yedikçe yedim şuan yerimden kıpırdayamıyorum 😂😂😂
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşil Biber,2 adet Yeşil Biber+Zeytin+Kekik)
. Zeytinyağlı Pirinçli Kabak Yemeği
(Tabağa ilave olarak 4 kepçe daha yedim)
.Kırmızı Mercimek Çorbası ( görseldeki 2 kepçe üzerine 2 kepçe daha yedim)
. Zeytinyağı döktüğüm Buharda Pişmiş Yeşil Biber
. Hindi Fümeli Mısır Unlu Kabak Mücveri ( 3 dilim yedim)
.250 mL Kefir .ilave olarak - Sulu Patates Yemeği ,4 tane Horoz Eriği ve Karpuz
.
#aksamyemegi#dinner#saglik#mücver#kabak#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#mercimekcorbasi#hindifümelimücver#glutensizmücver#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#kabakyemeği#firindamucver#sagliklibesleniyoruz#kefir#beforeafter#fitmucver
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 Yedikçe yedim yedikçe yedim şuan yerimden kıpırdayamıyorum 😂😂😂 . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşil Biber,2 adet Yeşil Biber+Zeytin+Kekik) . Zeytinyağlı Pirinçli Kabak Yemeği (Tabağa ilave olarak 4 kepçe daha yedim) .Kırmızı Mercimek Çorbası ( görseldeki 2 kepçe üzerine 2 kepçe daha yedim) . Zeytinyağı döktüğüm Buharda Pişmiş Yeşil Biber . Hindi Fümeli Mısır Unlu Kabak Mücveri ( 3 dilim yedim) .250 mL Kefir .ilave olarak - Sulu Patates Yemeği ,4 tane Horoz Eriği ve Karpuz . #aksamyemegi #dinner #saglik #mücver #kabak #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #mercimekcorbasi #hindifümelimücver #glutensizmücver #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #kabakyemeği #firindamucver #sagliklibesleniyoruz #kefir #beforeafter #fitmucver 
Y: Pardon merhaba, ben sos satın alacaktım.
Burger king kasiyer: Hangi sos?
Y: Tüm paketli soslarınızı alayım lütfen.
Burger king kasiyer: 3.50₺
❗️“Toplam 3.50 ₺ 9 paket sos =531 kkal”
🍔 Bir fast food restorantından beklentimiz lezzet ve hızlı doygunluk ucuza fazlasını elde etmek.
🍟 Bu sosların ucuz olması ve yüksek kalorili olması bu amaca hizmet ediyor o yüzden beni ilgilendiren konu yapaylığı..Birçok renklendirici,koruyucu,aroma verici var.
🥤Bir fast food restorantına gidecekseniz: bir hamburger-patates kızartması sipariş verdiğinizde;
✅ Ekstra tuz koymayın
✅ İçecek tercihim su
✅ Lütfen hiç sos koymadan her şeyi hazırlayın
✅ Büyük seçim istemiyorum
✅ Sos satın almayacağım
✅ Tatlı indirimli dahi olsa yemekten sonra yemeyeceğim diyin.
♥️ Bu size -500 kkal demek olacak😊 daha önemlisi daha sağlıklı karaciğer demek olacak⭐️ #Repost @yagmurun.elinden
.
.
#sagliklibeslenme #saglikliyasam #sagliklihayat #saglikliyasiyoruz #mcdonalds #mcdonald #mcdonalds🍟 #burgerking #burger #burgerking🍔 #ketcap #ketçap #mayonez #acısos #hardal #diyetteyim #diyetteyiz #diyet #hamburger #patateskızartması #kızartma #kizartma
Y: Pardon merhaba, ben sos satın alacaktım. Burger king kasiyer: Hangi sos? Y: Tüm paketli soslarınızı alayım lütfen. Burger king kasiyer: 3.50₺ ❗️“Toplam 3.50 ₺ 9 paket sos =531 kkal” 🍔 Bir fast food restorantından beklentimiz lezzet ve hızlı doygunluk ucuza fazlasını elde etmek. 🍟 Bu sosların ucuz olması ve yüksek kalorili olması bu amaca hizmet ediyor o yüzden beni ilgilendiren konu yapaylığı..Birçok renklendirici,koruyucu,aroma verici var. 🥤Bir fast food restorantına gidecekseniz: bir hamburger-patates kızartması sipariş verdiğinizde; ✅ Ekstra tuz koymayın ✅ İçecek tercihim su ✅ Lütfen hiç sos koymadan her şeyi hazırlayın ✅ Büyük seçim istemiyorum ✅ Sos satın almayacağım ✅ Tatlı indirimli dahi olsa yemekten sonra yemeyeceğim diyin. ♥️ Bu size -500 kkal demek olacak😊 daha önemlisi daha sağlıklı karaciğer demek olacak⭐️ #Repost  @yagmurun.elinden . . #sagliklibeslenme  #saglikliyasam  #sagliklihayat  #saglikliyasiyoruz  #mcdonalds  #mcdonald  #mcdonalds 🍟 #burgerking  #burger  #burgerking 🍔 #ketcap  #ketçap  #mayonez  #acısos  #hardal  #diyetteyim  #diyetteyiz  #diyet  #hamburger  #patateskızartması  #kızartma  #kizartma 
Ben yine @saglikcibiranne nin gönderilerini izinsiz #repost ediyorum😊 sağlıkçı bir anne düşünün bildiklerini paylaşmayı seçen... ve tam da bizlerin ihtiyacı olan, araştırdığı bilgi kirliliğinde boğulduğu konular 👍👍 çok teşekkürler 
#Repost @saglikcibiranne with @get_repost
・・・
Hemogram 
Demir
Ferritin 
Vitamin B12 
Folik 
Vitamin D 
Cinko 
Hatta günümüzün sorunu alerji icin Total igE de eklenebilir. Genel bir alerji testidir. 230 uzeri alerji yatkınlık gosterir. 
Lutfen kaydetmeden once begenelim🙏
.
.
#rodintahliller 
#saglikliyasiyoruz
#saglikliyasam
Ben yine @saglikcibiranne nin gönderilerini izinsiz #repost  ediyorum😊 sağlıkçı bir anne düşünün bildiklerini paylaşmayı seçen... ve tam da bizlerin ihtiyacı olan, araştırdığı bilgi kirliliğinde boğulduğu konular 👍👍 çok teşekkürler #Repost  @saglikcibiranne with @get_repost ・・・ Hemogram Demir Ferritin Vitamin B12 Folik Vitamin D Cinko Hatta günümüzün sorunu alerji icin Total igE de eklenebilir. Genel bir alerji testidir. 230 uzeri alerji yatkınlık gosterir. Lutfen kaydetmeden once begenelim🙏 . . #rodintahliller  #saglikliyasiyoruz  #saglikliyasam 
Beyin sağlığını bozan besinler hangileri? Detaylar kadinmax.com da.🤯
.
.
#sağlık #beyinsağlığı #saglikli #sagliklibeslenme #şeker #saglikliyasam #saglikliyasiyoruz  #sağlik #kadın #kadinmax #healty #sugar
Neden mi hiç kahvaltımı paylaşmıyorum? Çünkü o kokuların, tazecik domateslerin, peynirlerin arasında aklıma bile gelmiyor açıkçası #sorrynotsorry 🤷🏼‍♀️ Bugün de daha tabağıma diğer yiyeceklerimi bile eklemeden omletimi çekebildim anca.
Ben 2 yumurta beyazı, beyaz peynir, mantar ve maydanozlu yaptım bugün. Mis gibi de oldu 😋
Kahvaltı gibisi var mı ya soruyorum size. Her öğün yerim valla bıraksanız.
Yalnız peyniri biraz kısmam lazım 3 kişilik bi ailenin haftalık peynir tüketimini tek öğünde yedim yine 🤦‍♀️
Neden mi hiç kahvaltımı paylaşmıyorum? Çünkü o kokuların, tazecik domateslerin, peynirlerin arasında aklıma bile gelmiyor açıkçası #sorrynotsorry  🤷🏼‍♀️ Bugün de daha tabağıma diğer yiyeceklerimi bile eklemeden omletimi çekebildim anca. Ben 2 yumurta beyazı, beyaz peynir, mantar ve maydanozlu yaptım bugün. Mis gibi de oldu 😋 Kahvaltı gibisi var mı ya soruyorum size. Her öğün yerim valla bıraksanız. Yalnız peyniri biraz kısmam lazım 3 kişilik bi ailenin haftalık peynir tüketimini tek öğünde yedim yine 🤦‍♀️
Hemogram 
Demir
Ferritin 
Vitamin B12 
Folik 
Vitamin D 
Cinko 
Hatta günümüzün sorunu alerji icin Total igE de eklenebilir. Genel bir alerji testidir. 230 uzeri alerji yatkınlık gosterir. 
Lutfen kaydetmeden once begenelim🙏
.
.
#rodintahliller 
#saglikliyasiyoruz
#saglikliyasam
Hemogram Demir Ferritin Vitamin B12 Folik Vitamin D Cinko Hatta günümüzün sorunu alerji icin Total igE de eklenebilir. Genel bir alerji testidir. 230 uzeri alerji yatkınlık gosterir. Lutfen kaydetmeden once begenelim🙏 . . #rodintahliller  #saglikliyasiyoruz  #saglikliyasam 
Hepatit C hastası olan anneden doğan bebeğe hastalık hangi yolla bulaşır?

Hepatit C hastalığı olan annelerden bebeğe bulaş mümkündür. Ancak şu bilgi unutulmamalıdır; annede anti HCV testi pozitif iken bebek doğduğunda da anti HCV testi pozitiftir bu bebekteki anti HCV pozitifliği anneden geçen antikorlar nedeniyledir. Onun içindir ki yeni doğan bebeklerde ilk on sekiz ay boyunca anti HCV testi pozitifti.
Ama bu bebekte hepatit C hastalığı olduğu anlamına gelmez. Değerlendirme yapmak için on sekizinci aydan sonra bebekte anti HCV bakmak gerekir, eğer anti HCV on sekizinci aydan sonrada pozitif ise o zaman bebekte HCVRNA testine bakıp RNA testi müspet ise bebekte hepatit C hastalığından bahsedilir.

#sindirimuzmani #tgd #sindirim #karaciger #karacigerhastaliklari #hepatit #hepatittedavisi #hbv  #siroz #karacigertedavi #saglik #yasam #hayat #saglikliyaşam #saglikli #saglikolsun #saglikliyasiyoruz #hastalik #tıp #hekim #doktor #uzman #tedavi #instahealth #instagood #like4like #likeforlike #instaturkey
Hepatit C hastası olan anneden doğan bebeğe hastalık hangi yolla bulaşır? Hepatit C hastalığı olan annelerden bebeğe bulaş mümkündür. Ancak şu bilgi unutulmamalıdır; annede anti HCV testi pozitif iken bebek doğduğunda da anti HCV testi pozitiftir bu bebekteki anti HCV pozitifliği anneden geçen antikorlar nedeniyledir. Onun içindir ki yeni doğan bebeklerde ilk on sekiz ay boyunca anti HCV testi pozitifti. Ama bu bebekte hepatit C hastalığı olduğu anlamına gelmez. Değerlendirme yapmak için on sekizinci aydan sonra bebekte anti HCV bakmak gerekir, eğer anti HCV on sekizinci aydan sonrada pozitif ise o zaman bebekte HCVRNA testine bakıp RNA testi müspet ise bebekte hepatit C hastalığından bahsedilir. #sindirimuzmani  #tgd  #sindirim  #karaciger  #karacigerhastaliklari  #hepatit  #hepatittedavisi  #hbv   #siroz  #karacigertedavi  #saglik  #yasam  #hayat  #saglikliyaşam  #saglikli  #saglikolsun  #saglikliyasiyoruz  #hastalik  #tıp  #hekim  #doktor  #uzman  #tedavi  #instahealth  #instagood  #like4like  #likeforlike  #instaturkey 
1 demet reyhan kaynamis 1 lt suyun icinde, yarim seylan tarcin ve karanfil ile bekletilir.
soguduktan sonra istenen miktarda limon suyu eklenir.

sekersiz oldugu icin pek de icimi acti diyemem ama rayihasi farkli bir sey, cok seveni mutlaka cikacaktir

#reyhan#tarif#saglık#organik#yaşam#keto#saglikliyasiyoruz#like#istanbul#red#drink#keto#icecektarifi#bir_dakika
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
Efsaneeee bir tabak 😍😍😍
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşik Biber,2 adet Yeşil Biber+Zeytin+Kekik)
. Zeytinyağlı Pirinçli Kabak Yemeği
. Hindi Fümeli Makarna 🍝
.250 mL Kefir ( Zerdeçal+Karabiber)
.ilave olarak Sulu Patates Yemeği ,Peynir ve Kabak yemeği
.
#aksamyemegi#dinner#saglik#makarna#kabak#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#pasta#hindifüme#füme#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#kabakyemeği#şalgamsuyu#sagliklibesleniyoruz#hindieti#beforeafter#zerdeçal
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 Efsaneeee bir tabak 😍😍😍 . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+2 adet Salatalık+Domates+2 adet Acı Yeşik Biber,2 adet Yeşil Biber+Zeytin+Kekik) . Zeytinyağlı Pirinçli Kabak Yemeği . Hindi Fümeli Makarna 🍝 .250 mL Kefir ( Zerdeçal+Karabiber) .ilave olarak Sulu Patates Yemeği ,Peynir ve Kabak yemeği . #aksamyemegi #dinner #saglik #makarna #kabak #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #pasta #hindifüme #füme #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #kabakyemeği #şalgamsuyu #sagliklibesleniyoruz #hindieti #beforeafter #zerdeçal 
Geç saate kalınca Iskender'e talim..altındaki ekmeklere, pidelere dokunmadan üzerindeki etleri ve bir çatal yoğurt yedim..ekstradan tereyağ ilave ettirdim,bol yağlı😋😋
~~~~~~~~~~~~~~~~~~~
#ketojenikdiyet #ketojenikbeslenme #ketojenikyasam #ketofriendly #ketogenicdiet #ketogenicliving #ketogeniclife #temizbeslenme #eatfatlosefat #ketodiet #lchflifestyle #nasılbeslenmeliyim #saglikliyasiyoruz #nasilkiloveririm #diyetsizkiloverme #fitnessmotivation #weightloss #healthydinner #ketodinner #lowcarbdinner #ketolove #iloveketo #ketoif #eatfatburnfat #flexibledieting #iskenderkebap #diyetkardesligi #lowcarb #abendessen #mydinner
Geç saate kalınca Iskender'e talim..altındaki ekmeklere, pidelere dokunmadan üzerindeki etleri ve bir çatal yoğurt yedim..ekstradan tereyağ ilave ettirdim,bol yağlı😋😋 ~~~~~~~~~~~~~~~~~~~ #ketojenikdiyet  #ketojenikbeslenme  #ketojenikyasam  #ketofriendly  #ketogenicdiet  #ketogenicliving  #ketogeniclife  #temizbeslenme  #eatfatlosefat  #ketodiet  #lchflifestyle  #nasılbeslenmeliyim  #saglikliyasiyoruz  #nasilkiloveririm  #diyetsizkiloverme  #fitnessmotivation  #weightloss  #healthydinner  #ketodinner  #lowcarbdinner  #ketolove  #iloveketo  #ketoif  #eatfatburnfat  #flexibledieting  #iskenderkebap  #diyetkardesligi  #lowcarb  #abendessen  #mydinner 
D Vitamini içeren 10 Önemli Besin

1) Güneş Işığı , 2) Balık Yağı, 3) Sardalya Balığı, 4) Somon Balığı, 5) Uskumru Balığı, 6) Ton Balığı, 7) Pastörize Edilmemiş Süt, 8) Havyar, 9) Yumurta, 10) Mantar

Gün boyu yeterince güneş ışığı alarak, bu D vitamini yönünden zengin yiyeceklerden iki tanesini tüketmeniz yeterli olacaktır.

#ketogenic #ketosis #ketogeniclife #foodoftheday #cleaneating #ketojenikdiyet #ketofriendly #highfatlowcarb #nasılbeslenmeliyim #saglikliyiz #saglikliyasiyoruz #temizbeslenme #neyesek #yagyeyagyak #ketojenikbeslenme #ketojenikyasam #lchf #ketofood #paleodiyet #paleo #karatay #karataydiyeti #yemektarifleri #dvitamini
D Vitamini içeren 10 Önemli Besin 1) Güneş Işığı , 2) Balık Yağı, 3) Sardalya Balığı, 4) Somon Balığı, 5) Uskumru Balığı, 6) Ton Balığı, 7) Pastörize Edilmemiş Süt, 8) Havyar, 9) Yumurta, 10) Mantar Gün boyu yeterince güneş ışığı alarak, bu D vitamini yönünden zengin yiyeceklerden iki tanesini tüketmeniz yeterli olacaktır. #ketogenic  #ketosis  #ketogeniclife  #foodoftheday  #cleaneating  #ketojenikdiyet  #ketofriendly  #highfatlowcarb  #nasılbeslenmeliyim  #saglikliyiz  #saglikliyasiyoruz  #temizbeslenme  #neyesek  #yagyeyagyak  #ketojenikbeslenme  #ketojenikyasam  #lchf  #ketofood  #paleodiyet  #paleo  #karatay  #karataydiyeti  #yemektarifleri  #dvitamini 
Karnabahardan yaptığım pizzayı yaz döneminde yeşil kabak ile denedim ve sonuç mükemmel☺
1 adet büyük boy yeşil kabağı rendeleyip suyunu iyice sıkın. Ardından 1 yumurta,1 çay bardağı kaşar peyniri rendesi,tuz,karabiber ekleyip iyice karıştırın ve yağlı kağıt serili fırın tepsisine elinizle şekil vererek yayın. Üzerin için 1 tatlı kaşığı domates salçası, tuz,kekik ve karabiberi karıştırıp hafif suyla açarak sürülebilir bir kıvama getirin. Üzerine yayın ve kasar peyniri rendesi serpil arzu ettiğiniz malzemelerle süsleyin. 180 derece de kızarana kadar pişirin. Fırından alın tekrar kasar peyniri serpin ve eriyene kadar tekrar fırınlayıp afiyetle yiyin. Sağlıklı günler 🤗
Karnabahardan yaptığım pizzayı yaz döneminde yeşil kabak ile denedim ve sonuç mükemmel☺ 1 adet büyük boy yeşil kabağı rendeleyip suyunu iyice sıkın. Ardından 1 yumurta,1 çay bardağı kaşar peyniri rendesi,tuz,karabiber ekleyip iyice karıştırın ve yağlı kağıt serili fırın tepsisine elinizle şekil vererek yayın. Üzerin için 1 tatlı kaşığı domates salçası, tuz,kekik ve karabiberi karıştırıp hafif suyla açarak sürülebilir bir kıvama getirin. Üzerine yayın ve kasar peyniri rendesi serpil arzu ettiğiniz malzemelerle süsleyin. 180 derece de kızarana kadar pişirin. Fırından alın tekrar kasar peyniri serpin ve eriyene kadar tekrar fırınlayıp afiyetle yiyin. Sağlıklı günler 🤗
Kolonoskopi öncesi sıvı tüketimim ne kadar olmalı?

Özellikle kolonoskopi öncesi sıvı tüketiminin miktarı yapılacak olan temizleme miktarına bağlıdır.
Ama ne kadar çok sıvı tüketirsek daha iyidir. Bazen özellikle kolonoskopiye hazırlık döneminde sizlere 3 veya 4 lt içerisinde eritilen ilaçlar verilmektedir. Bunların tüketilmesi yeterlidir.

#sindirimuzmani #tgd #sindirim #bagirsak#kolonoskopi #bagirsakhastaliklari #kalinbagirsak#bagirsakkanseri #kanser #kolonoskopi #ishal#kabizlik #ibs #chron #ulseratifkolit #saglik #yasam#hayat #saglikliyaşam #saglikolsun#saglikliyasiyoruz #hastalik #tıp #doktor #tedavi#instahealth #instagood #like4like #likeforlike#instaturkey
Kolonoskopi öncesi sıvı tüketimim ne kadar olmalı? Özellikle kolonoskopi öncesi sıvı tüketiminin miktarı yapılacak olan temizleme miktarına bağlıdır. Ama ne kadar çok sıvı tüketirsek daha iyidir. Bazen özellikle kolonoskopiye hazırlık döneminde sizlere 3 veya 4 lt içerisinde eritilen ilaçlar verilmektedir. Bunların tüketilmesi yeterlidir. #sindirimuzmani  #tgd  #sindirim  #bagirsak #kolonoskopi  #bagirsakhastaliklari  #kalinbagirsak #bagirsakkanseri  #kanser  #kolonoskopi  #ishal #kabizlik  #ibs  #chron  #ulseratifkolit  #saglik  #yasam #hayat  #saglikliyaşam  #saglikolsun #saglikliyasiyoruz  #hastalik  #tıp  #doktor  #tedavi #instahealth  #instagood  #like4like  #likeforlike #instaturkey 
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+Salatalık+Domates+2 adet Acı Yeşil Biber,2 adet Yeşil Biber+Zeytin+Kekik ve daha sonradan üzerine 10 adet çiğ Fındık ekledim)
. Taze Fasulye Yemeği
.3 kepçe Tarhana Çorbası ve 250 mL ev yapımı Kefir ( Zerdeçal+Karabiber+pulbiber)
.ilave olarak Karpuz ve Fındık yedim.
.
#aksamyemegi#dinner#saglik#kefir#tazefasulye#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#karpuz#çobansalata#ketentohumu#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#tarhana#zerdeçal#sagliklibesleniyoruz#evyapimikefir#beforeafter#tarhanacorbasi
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+Salatalık+Domates+2 adet Acı Yeşil Biber,2 adet Yeşil Biber+Zeytin+Kekik ve daha sonradan üzerine 10 adet çiğ Fındık ekledim) . Taze Fasulye Yemeği .3 kepçe Tarhana Çorbası ve 250 mL ev yapımı Kefir ( Zerdeçal+Karabiber+pulbiber) .ilave olarak Karpuz ve Fındık yedim. . #aksamyemegi #dinner #saglik #kefir #tazefasulye #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #karpuz #çobansalata #ketentohumu #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #tarhana #zerdeçal #sagliklibesleniyoruz #evyapimikefir #beforeafter #tarhanacorbasi 
Ananas #pineapple #ananas Excelente #excelente farkı ile seçkin Migros #migros ve MacroCenter #macrocenter ‘larda👍🏼 @macrocentertr @migros_tr @excelente_egetropikal 
#meyveseverler #goodday #saglikliyasam #sagliklibeslenme #love #egetropikal #saglikliyasiyoruz #ananas🍍 #tropikal #tropicalfruits #tropical #meyveseverler #meyveyabagi #sebzeler #egzotikmeyveler #migroskop #egetropikal #istanbul #türkiye #izmir
Günaydın 🙋🏻‍♀️
Arkadaşlarla kahvaltı yapınca tabi biraz da kaçamak oluyor, görseldekilere ek olarak tereyağlı simit 👌🏻 Yürüyüşle telafi ederiz 😊
.
#kahvalti #breakfast #lepetitdejeuner #saglikliyasiyoruz #zayifliyoruz #fitoluyoruz #diyetkardesligi #sagliklitabaklar #healthyplates #cleaneating #temizbeslenme #healthyeating #sagliklibeslenme #yeshealth #weightlossdiary #zayiflamagunlugu #diyetgunlugu #nodietyeshealth #health #sekersizyasam #nosugar #yapaysekerehayir #ofistesaglikvar
Günaydın 🙋🏻‍♀️ Arkadaşlarla kahvaltı yapınca tabi biraz da kaçamak oluyor, görseldekilere ek olarak tereyağlı simit 👌🏻 Yürüyüşle telafi ederiz 😊 . #kahvalti  #breakfast  #lepetitdejeuner  #saglikliyasiyoruz  #zayifliyoruz  #fitoluyoruz  #diyetkardesligi  #sagliklitabaklar  #healthyplates  #cleaneating  #temizbeslenme  #healthyeating  #sagliklibeslenme  #yeshealth  #weightlossdiary  #zayiflamagunlugu  #diyetgunlugu  #nodietyeshealth  #health  #sekersizyasam  #nosugar  #yapaysekerehayir  #ofistesaglikvar 
Kabızlık için hangi branşa başvurabilirim?

Kabızlık için eğer kişi erişkinse on sekiz yaşının üzerindeyse, bir erişkin gastroenteroloji uzmanına başvurması gerekir eğer çocuk yaş grubunda ise bir pediatrik gastroenteroloji uzmanına başvurması uygun olur.

#sindirimuzmani #tgd #sindirim #bagirsak #kolonoskopi #bagirsakhastaliklari #kalinbagirsak #bagirsakkanseri #kanser #kolonoskopi #ishal #kabizlik  #ibs #chron #ulseratifkolit #saglik #yasam #hayat #saglikliyaşam #saglikolsun #saglikliyasiyoruz #hastalik #tıp #doktor #tedavi #instahealth #instagood #like4like #likeforlike #instaturkey
Kabızlık için hangi branşa başvurabilirim? Kabızlık için eğer kişi erişkinse on sekiz yaşının üzerindeyse, bir erişkin gastroenteroloji uzmanına başvurması gerekir eğer çocuk yaş grubunda ise bir pediatrik gastroenteroloji uzmanına başvurması uygun olur. #sindirimuzmani  #tgd  #sindirim  #bagirsak  #kolonoskopi  #bagirsakhastaliklari  #kalinbagirsak  #bagirsakkanseri  #kanser  #kolonoskopi  #ishal  #kabizlik  #ibs  #chron  #ulseratifkolit  #saglik  #yasam  #hayat  #saglikliyaşam  #saglikolsun  #saglikliyasiyoruz  #hastalik  #tıp  #doktor  #tedavi  #instahealth  #instagood  #like4like  #likeforlike  #instaturkey 
Mutfakta dolanmaya başladım canım bişeyler çekiyordu. Şu susamlı şekerden bi tane atsam ağzımaaaa.... kuruyemiş mi yeseeemmm..... Kendine gel kız dedim😃😂😂ocağın üstündeki kiraz sapı çayına yöneldim içine bi tanede çubuk tarçın atıp ısıttım, şekersiz, kaptığım gibi doğru balkona👏🏻👏🏻👏🏻 Hava misss gibi.
.
.
.
.
.
#diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
Mutfakta dolanmaya başladım canım bişeyler çekiyordu. Şu susamlı şekerden bi tane atsam ağzımaaaa.... kuruyemiş mi yeseeemmm..... Kendine gel kız dedim😃😂😂ocağın üstündeki kiraz sapı çayına yöneldim içine bi tanede çubuk tarçın atıp ısıttım, şekersiz, kaptığım gibi doğru balkona👏🏻👏🏻👏🏻 Hava misss gibi. . . . . . #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
•Heyoooğ meyooğ arkadaslar daha yuz takıpcım olmasına ragmen cok guzel tepkıler alıyorum bunun ıcın cok tesekkur edıyorum daha cok tesekkur edecegım zamanlar temennı olur umarım bu tarıfım tatlıs takıpcım @betulbyrakk ıstedıgı ıcın gelsın ısteee karsınızdaağ sebzelı & tavuklu ultra saglıklı bır tarıfım var. Ustelık gram yag kullanmadım evet evet dogru okudunuz gram yag yok tabı tercıh edenlerınız bır yemek kasıgı zeytınyagı ılave edebılır.
Icındekıler;
-Patates
-Havuc
-Kabak
-Tavuk
Efenım butun malzemelerı dogruyorsunuz tavuklar kusbası seklınde olacak. Sımdııı duduklu tencerede tavuklarınızın bır tık ustune kadar su ve yarım lımon sıkarak 10 dakıkaya yakın orta ateste haslıyorsunuz. Daha sonra atesı bıraz kısıyorsunuz kapagını acıyorsunuz. (Yenı olan duduklu tencereler ocagın uzerındeyken kapagı acılabılıyor sızınkı farklıysa ona gore hareket edın aman dıkkatlı olun mınnoskolar) neyseeeğ patateslerı eklıyorsunuz. (Istersenız baska tencereye alabılırsınız ben duduklude pısırmeye devam edıyorum) 5-10 dakıka pısırılmeye bırakılan tavuk ve patateslere havucları ılave edıyorsunuz efenım yıne bıraz bekledıkten sonra kabakları eklıyorsunuz. Cunku kabaklar cabuk haslanıyor ve dırı kalmıyor. Hepsını bır guzel karıstırdıktan sonra tuz ve baharatlarınızı eklıyorsunuz. Ben pul bıber, az karabıber ve feslegen eklıyorum hatta bazen keten tohumu bıle oluyor. Kısık ateste pısmeye devam eden yemegınızın enfes kokuları geldıgınde artık atesı kapatıp mınık defne yapragı ıle buharında demlemeye bırakıyorsunuz. 5-10 dakıka sonra defne yapragını alın servıs ederken maydanoz veya dereotu ıle suslemelerınızı yapın efenımm
Afıyet olsun, kalorılerınız kaybolsun xo💋
•Heyoooğ meyooğ arkadaslar daha yuz takıpcım olmasına ragmen cok guzel tepkıler alıyorum bunun ıcın cok tesekkur edıyorum daha cok tesekkur edecegım zamanlar temennı olur umarım bu tarıfım tatlıs takıpcım @betulbyrakk ıstedıgı ıcın gelsın ısteee karsınızdaağ sebzelı & tavuklu ultra saglıklı bır tarıfım var. Ustelık gram yag kullanmadım evet evet dogru okudunuz gram yag yok tabı tercıh edenlerınız bır yemek kasıgı zeytınyagı ılave edebılır. Icındekıler; -Patates -Havuc -Kabak -Tavuk Efenım butun malzemelerı dogruyorsunuz tavuklar kusbası seklınde olacak. Sımdııı duduklu tencerede tavuklarınızın bır tık ustune kadar su ve yarım lımon sıkarak 10 dakıkaya yakın orta ateste haslıyorsunuz. Daha sonra atesı bıraz kısıyorsunuz kapagını acıyorsunuz. (Yenı olan duduklu tencereler ocagın uzerındeyken kapagı acılabılıyor sızınkı farklıysa ona gore hareket edın aman dıkkatlı olun mınnoskolar) neyseeeğ patateslerı eklıyorsunuz. (Istersenız baska tencereye alabılırsınız ben duduklude pısırmeye devam edıyorum) 5-10 dakıka pısırılmeye bırakılan tavuk ve patateslere havucları ılave edıyorsunuz efenım yıne bıraz bekledıkten sonra kabakları eklıyorsunuz. Cunku kabaklar cabuk haslanıyor ve dırı kalmıyor. Hepsını bır guzel karıstırdıktan sonra tuz ve baharatlarınızı eklıyorsunuz. Ben pul bıber, az karabıber ve feslegen eklıyorum hatta bazen keten tohumu bıle oluyor. Kısık ateste pısmeye devam eden yemegınızın enfes kokuları geldıgınde artık atesı kapatıp mınık defne yapragı ıle buharında demlemeye bırakıyorsunuz. 5-10 dakıka sonra defne yapragını alın servıs ederken maydanoz veya dereotu ıle suslemelerınızı yapın efenımm Afıyet olsun, kalorılerınız kaybolsun xo💋
Merhabalarrr uzun zamandir yoktum hastamiz var onunla ilgileniyorum o yüzden herkesten Özür diliyorim ^^ bugünku akşam yemeğim budur saat 6 da yedim daha yeni atabildim -Haşlanmış tavuk
-kendi tarifim olan bezelyeli patatesli şehriyeli ve yesillikli olan salatam
-tuzsuz buz gibi bir ayran

Biraz fazla salata yemiş olabilirim olur öyle şeyler ^-^
Merhabalarrr uzun zamandir yoktum hastamiz var onunla ilgileniyorum o yüzden herkesten Özür diliyorim ^^ bugünku akşam yemeğim budur saat 6 da yedim daha yeni atabildim -Haşlanmış tavuk -kendi tarifim olan bezelyeli patatesli şehriyeli ve yesillikli olan salatam -tuzsuz buz gibi bir ayran Biraz fazla salata yemiş olabilirim olur öyle şeyler ^-^
Güne #elmasirkelisu ile başlayıp metabolizmayı çalıştırıp, sindirim sistemi temizleyip Sonra yürüyüşe çıkalım.
Yani ben öyle yaptım.
Artık yeniden erken yürüyüş zamanı.Saat 8:00 sonra dışarı çıkilmıyor.
#cleanse #appelcidervinegar
#arinma#günaydin#alkalidiyet#saglikli#healthydrink#trmizbeslen#temizlik#sagliklibeslenme#saglikliyasiyoruz#alkalibeslenme#diyethesaplaritakiplesiyor #diyetteyiz#kilo#kilovermek #fitolmak#beslenme#elmasirkesi
Güne #elmasirkelisu  ile başlayıp metabolizmayı çalıştırıp, sindirim sistemi temizleyip Sonra yürüyüşe çıkalım. Yani ben öyle yaptım. Artık yeniden erken yürüyüş zamanı.Saat 8:00 sonra dışarı çıkilmıyor. #cleanse  #appelcidervinegar  #arinma #günaydin #alkalidiyet #saglikli #healthydrink #trmizbeslen #temizlik #sagliklibeslenme #saglikliyasiyoruz #alkalibeslenme #diyethesaplaritakiplesiyor  #diyetteyiz #kilo #kilovermek  #fitolmak #beslenme #elmasirkesi 
09.07.2018 saat ⏰10.00
Günaydın..klasik bir başlangıç olacak ama her pazartesi olduğu gibi protein ve yağdan zengin bir menü hazırladım..
🔼hindi jambonlu iki doğal  yumurtalı omlet ve üzerinde bol lif içeren çiğ susam ve iki kaşık sızma zeytinyağı..
🔼yanında tamyağlı,şirden mayalı beyaz peynir ve kendi yaptığım zeytinler..
🔼cevizden ve maydanozdan da karbonhidrat hakkımı tamamladım..ceviz ayrıca sağlıklı yağ asitlerini de içeriyor..işlem tamam😊👍
~~~~~~~~~~~~~~~~~~~
#ketojenikdiyet #ketojenikbeslenme #hflclife #anticandida #nasilbeslenmeliyim #fitnessfoods #dieting #fitnessmotivation #worldfoods #cheflife #nasilkiloveririm #sagliklibeslenme #saglikliyiz #saglikliyasiyoruz #ketogenicbreakfast #igersfood #instafood #kahvaltizamani #ketoif #nogluten #cleanfood #healthybreakfast #lowcarbbreakfast #ketobreakfast #frühstück #breakfasttime #dengelibeslenme #weightloss #temizyasam #diyetkardesligi
09.07.2018 saat ⏰10.00 Günaydın..klasik bir başlangıç olacak ama her pazartesi olduğu gibi protein ve yağdan zengin bir menü hazırladım.. 🔼hindi jambonlu iki doğal yumurtalı omlet ve üzerinde bol lif içeren çiğ susam ve iki kaşık sızma zeytinyağı.. 🔼yanında tamyağlı,şirden mayalı beyaz peynir ve kendi yaptığım zeytinler.. 🔼cevizden ve maydanozdan da karbonhidrat hakkımı tamamladım..ceviz ayrıca sağlıklı yağ asitlerini de içeriyor..işlem tamam😊👍 ~~~~~~~~~~~~~~~~~~~ #ketojenikdiyet  #ketojenikbeslenme  #hflclife  #anticandida  #nasilbeslenmeliyim  #fitnessfoods  #dieting  #fitnessmotivation  #worldfoods  #cheflife  #nasilkiloveririm  #sagliklibeslenme  #saglikliyiz  #saglikliyasiyoruz  #ketogenicbreakfast  #igersfood  #instafood  #kahvaltizamani  #ketoif  #nogluten  #cleanfood  #healthybreakfast  #lowcarbbreakfast  #ketobreakfast  #frühstück  #breakfasttime  #dengelibeslenme  #weightloss  #temizyasam  #diyetkardesligi 
Bu tadlı renkli çayda kiraz 🍒 sapının çayı. Neye iyi gelir diye bi baktım ve kopyaladım bayağı yararlıymış meğerse:
‼️Sakinleştirici etkisi vardır
‼️Susuzluğu giderir
‼️Böbreklere faydalıdır
‼️İdrar söktürücüdür
‼️Kanı temizler
‼️Böbrek taşı oluşumunu geciktirir
‼️Kolesterolün düşürülmesine yardımcıdır
‼️Fazla suyun vücuttan atılmasına yardımcı olur
‼️Karaciğere faydalıdır
‼️Kilo vermeye yardımcıdır
‼️İdrar yolu enfeksiyonlarına iyi gelir‼️‼️
.
.
.
.
.
#diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
Bu tadlı renkli çayda kiraz 🍒 sapının çayı. Neye iyi gelir diye bi baktım ve kopyaladım bayağı yararlıymış meğerse: ‼️Sakinleştirici etkisi vardır ‼️Susuzluğu giderir ‼️Böbreklere faydalıdır ‼️İdrar söktürücüdür ‼️Kanı temizler ‼️Böbrek taşı oluşumunu geciktirir ‼️Kolesterolün düşürülmesine yardımcıdır ‼️Fazla suyun vücuttan atılmasına yardımcı olur ‼️Karaciğere faydalıdır ‼️Kilo vermeye yardımcıdır ‼️İdrar yolu enfeksiyonlarına iyi gelir‼️‼️ . . . . . #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
💞💞Bu gün yediklerim sabah sütlü kahve ☕️ öğlen büyük bardak ayran, saat 5 gibi yoğurtlu kabak salatası,  akşam bir avuç badem ve 12 adet kiraz 🍒 🍒🍒 #şekersiz21gün 7. gün.
.
.
.
.
#diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
💞💞Bu gün yediklerim sabah sütlü kahve ☕️ öğlen büyük bardak ayran, saat 5 gibi yoğurtlu kabak salatası, akşam bir avuç badem ve 12 adet kiraz 🍒 🍒🍒 #şekersiz21gün  7. gün. . . . . #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
11 Temmuz listemiz belirlendi!
Haftanın listesini standart haliyle sipariş edebileceğiniz gibi, liste içindeki ürünlerden istemediklerinizi çıkartıp, alternatif listedeki ürünlerimiz ile değiştirebilirsiniz.
Sebzekutusu’nun fiyatı her hafta standart olup, kargo bedeli ve KDV dahil 139 TL’dir.
Sebzekutusu gönderimleri yalnızca Çarşamba günleri UPS kargo ile yapılmakta ve kutunuz Perşembe günü size teslim edilmektedir.

Siparişleriniz için ➡DM ➡Whatsapp: 0 530 735 10 77 ➡www.sebzekutusu.com

#yereltohum #atalıktohum #domates #biber #salatalık #patlıcan #tazesebze #tazemeyve #organikgıda #saglikliyasam #saglikliyasiyoruz #sağlıklıyaşıyoruz #sagliklibeslenme #sebzekutusu #veggiebox #sebze #meyve #diyet #gapsdiyeti #glutensiz #vegan #vejeteryan #gdosuz #familyfarming #knowyourfarmer #knowyourfood
11 Temmuz listemiz belirlendi! Haftanın listesini standart haliyle sipariş edebileceğiniz gibi, liste içindeki ürünlerden istemediklerinizi çıkartıp, alternatif listedeki ürünlerimiz ile değiştirebilirsiniz. Sebzekutusu’nun fiyatı her hafta standart olup, kargo bedeli ve KDV dahil 139 TL’dir. Sebzekutusu gönderimleri yalnızca Çarşamba günleri UPS kargo ile yapılmakta ve kutunuz Perşembe günü size teslim edilmektedir. Siparişleriniz için ➡DM ➡Whatsapp: 0 530 735 10 77 ➡www.sebzekutusu.com #yereltohum  #atalıktohum  #domates  #biber  #salatalık  #patlıcan  #tazesebze  #tazemeyve  #organikgıda  #saglikliyasam  #saglikliyasiyoruz  #sağlıklıyaşıyoruz  #sagliklibeslenme  #sebzekutusu  #veggiebox  #sebze  #meyve  #diyet  #gapsdiyeti  #glutensiz  #vegan  #vejeteryan  #gdosuz  #familyfarming  #knowyourfarmer  #knowyourfood 
Kahvaltı en önemli öğündür. Az kalorili ama sağlıklı olması için ⬆️🍽️
#diyet #diyetisyen #diyetyemekleri #diyetlistesi #diyetteyim #saglikliyasam #sagliklibeslenme #sagliklitarifler #saglikliyiz #saglikliyasiyoruz #sagliklizayiflama
ANLATMAYA,YORUMA GEREK YOOK,GÖRÜYORSUNUZ.
🐻😎
28-BÖREKLERİ ISITMIŞ,
24-EKMEKLERİ KIZARTMIŞ,
20-SUCUĞU YAPMIŞ,
16-YUMURTAYI ŞAKIRDATMIŞ. -ARTIK TEFLONCULAR DA  BİZDEN YİYOR HANIIIM-😂
------------'''''''''---------------
SİZ İSTEDİNİZ ,BİZ YAPTIK.
AZ KALDI,BEKLEYİN EFENDİM 🐻YAPMIŞ OLMAK İÇİN DEĞİL,İYİ OLANI YAPABİLMEK İÇİN UĞRAŞIYOR BU AYI KARDEŞİNİZ.BU PROJR İMKANSIZ DEĞİL,SADECE BİRAZ ZAMAN ALIYOR😎(FİYATLAR HENÜZ BELLİ DEĞİLDİR)
SATIŞTAN ÖNCELİKLİ HABERDAR OLMAK  İÇİN E-MAİL ADRESİNİZİ DM ATABİLİRSİNİZ,DUYURU LİSTESİNE EKLENECEK🐻💗🍳😀👍.Ham Döküm ürünler hakkında daha bi sürü şey icin👉youtube:dokumcubaba 👉DOKUMCUBABA.COM #dökümsahan #blackandbear #dökümcübaba #dokumcubaba #food  #instafood #dinner #eating #castiron #foodpic #foodporn#foodie  #dökümtava #turkishfood #mutfakgram #outdoor #camping #bushcraftturkiye #bushcraft #kampvedogahayati #dökümtavacandir #dokumtava #canankaratay #saglikliyasam #saglikliyasiyoruz  #bearfood #bear #ayi #ayı
ANLATMAYA,YORUMA GEREK YOOK,GÖRÜYORSUNUZ. 🐻😎 28-BÖREKLERİ ISITMIŞ, 24-EKMEKLERİ KIZARTMIŞ, 20-SUCUĞU YAPMIŞ, 16-YUMURTAYI ŞAKIRDATMIŞ. -ARTIK TEFLONCULAR DA BİZDEN YİYOR HANIIIM-😂 ------------'''''''''--------------- SİZ İSTEDİNİZ ,BİZ YAPTIK. AZ KALDI,BEKLEYİN EFENDİM 🐻YAPMIŞ OLMAK İÇİN DEĞİL,İYİ OLANI YAPABİLMEK İÇİN UĞRAŞIYOR BU AYI KARDEŞİNİZ.BU PROJR İMKANSIZ DEĞİL,SADECE BİRAZ ZAMAN ALIYOR😎(FİYATLAR HENÜZ BELLİ DEĞİLDİR) SATIŞTAN ÖNCELİKLİ HABERDAR OLMAK İÇİN E-MAİL ADRESİNİZİ DM ATABİLİRSİNİZ,DUYURU LİSTESİNE EKLENECEK🐻💗🍳😀👍.Ham Döküm ürünler hakkında daha bi sürü şey icin👉youtube:dokumcubaba 👉DOKUMCUBABA.COM #dökümsahan  #blackandbear  #dökümcübaba  #dokumcubaba  #food  #instafood  #dinner  #eating  #castiron  #foodpic  #foodporn #foodie  #dökümtava  #turkishfood  #mutfakgram  #outdoor  #camping  #bushcraftturkiye  #bushcraft  #kampvedogahayati  #dökümtavacandir  #dokumtava  #canankaratay  #saglikliyasam  #saglikliyasiyoruz  #bearfood  #bear  #ayi  #ayı 
🍌Banana icecream cake 🌞 Muz dondurmali kek.🍌
~
I have got a delicious healthy pudding recipe for you in this super hot weather. It is also so easy to make.
For the base:
🍌1 cup almond flour
🍌1 cup desiccated coconut 🍌50gr melted butter (Coconut oil would work for vegans)
🍌1 tsp vanilla extract 🍌Coconut sugar* (*Optional to taste )(I did not use any and it was just perfect for me.)
For the top layer:
🍌4 very ripe bananas
🍌150gr tahini
🍌1 tsp vanilla extract
Mix the almond flour and coconut very well, then add the melted butter and vanilla. Press the mixture with your hands in a springform pan. Then in another bowl, mash the bananas until completely smooth and add the tahini and the vanilla extract in it. Mix it all well and pour it on the base. Put it in the freezer and it should be ready to eat in 3 hours. I decorated it with raw cacao.☺
~
Bu sicak havalarda size harika, soguk muzlu bir kek tarifi gelsin o zaman.
Tabani icin:
🍌1 bardak badem unu
🍌1 bardak kurutulmus hindistan cevizi ici
🍌50 gr erimis tereyagi
🍌1 tatli kasigi vanilya özütü
🍌Hindistan cevizi sekeri (Damak tadiniza gore 1-2 tatli kasigi koyabilirsiniz, ben hic koymadim gayet guzel oldu.)
Ust kat için:
🍌4 adet cok olgun orta boy muz
🍌150 gr tahin
🍌1 tatli kasigi vanilya
Badem ve hindistan cevizini guzelce karistiriyoruz, tereyagi ve vanilya ozutunu de ekleyip kelepceli kek kalibinin dibine elimiz ile guzelce yayiyoruz. Ust katmani icin muzlari ayri bir kasede catalla puruzsuz olacak sekilde ezip, tahin ve vanilya ozutunu de ekledikten sonra tabanin uzerine bosaltip yayiyoruz. Buzlukta 3 saat kadar donduktan sonra servise hazir. (Uzerini ham kakao ile susledim.☺)
.
.
.
.
#banana #bananaicecreamcake
#healthypudding #kolaytarifler #sagliklitarifler #easyrecipes #eatclean #cleaneating #nicecream #sogukkek #coldcake #iamwellandgood #lifeisgood #feedyoursoul #fitspiration #superhealthykids #feedfeed #buzzfeast #buzzfeedfood #huffposttaste #yahoofood #instafood #foodphotography #glutenfree #grainfree #refinedsugarfree #saglikliyasiyoruz #foodlover
🍌Banana icecream cake 🌞 Muz dondurmali kek.🍌 ~ I have got a delicious healthy pudding recipe for you in this super hot weather. It is also so easy to make. For the base: 🍌1 cup almond flour 🍌1 cup desiccated coconut 🍌50gr melted butter (Coconut oil would work for vegans) 🍌1 tsp vanilla extract 🍌Coconut sugar* (*Optional to taste )(I did not use any and it was just perfect for me.) For the top layer: 🍌4 very ripe bananas 🍌150gr tahini 🍌1 tsp vanilla extract Mix the almond flour and coconut very well, then add the melted butter and vanilla. Press the mixture with your hands in a springform pan. Then in another bowl, mash the bananas until completely smooth and add the tahini and the vanilla extract in it. Mix it all well and pour it on the base. Put it in the freezer and it should be ready to eat in 3 hours. I decorated it with raw cacao.☺ ~ Bu sicak havalarda size harika, soguk muzlu bir kek tarifi gelsin o zaman. Tabani icin: 🍌1 bardak badem unu 🍌1 bardak kurutulmus hindistan cevizi ici 🍌50 gr erimis tereyagi 🍌1 tatli kasigi vanilya özütü 🍌Hindistan cevizi sekeri (Damak tadiniza gore 1-2 tatli kasigi koyabilirsiniz, ben hic koymadim gayet guzel oldu.) Ust kat için: 🍌4 adet cok olgun orta boy muz 🍌150 gr tahin 🍌1 tatli kasigi vanilya Badem ve hindistan cevizini guzelce karistiriyoruz, tereyagi ve vanilya ozutunu de ekleyip kelepceli kek kalibinin dibine elimiz ile guzelce yayiyoruz. Ust katmani icin muzlari ayri bir kasede catalla puruzsuz olacak sekilde ezip, tahin ve vanilya ozutunu de ekledikten sonra tabanin uzerine bosaltip yayiyoruz. Buzlukta 3 saat kadar donduktan sonra servise hazir. (Uzerini ham kakao ile susledim.☺) . . . . #banana  #bananaicecreamcake  #healthypudding  #kolaytarifler  #sagliklitarifler  #easyrecipes  #eatclean  #cleaneating  #nicecream  #sogukkek  #coldcake  #iamwellandgood  #lifeisgood  #feedyoursoul  #fitspiration  #superhealthykids  #feedfeed  #buzzfeast  #buzzfeedfood  #huffposttaste  #yahoofood  #instafood  #foodphotography  #glutenfree  #grainfree  #refinedsugarfree  #saglikliyasiyoruz  #foodlover 
Gec yapilan ve gec post edilen bi kahvalti😃 evde misafir olunca bi düzen bozulması yaşanıyor neyseki toparlamasını biliyoruz. .
.
.
.
#diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
Gec yapilan ve gec post edilen bi kahvalti😃 evde misafir olunca bi düzen bozulması yaşanıyor neyseki toparlamasını biliyoruz. . . . . #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
Havasıyla suyuyla cennet gibi Kazdağları. Kuzey yamaçlarındaki Yeşilköy elmalarından toplayıp kurduğumuz elma sirkelerimizin tadına şaşıracaksınız. Afiyet şifa olsun. . . ❌Kapıda ödeme yok
✔Türkiyenin heryerine anlaşmalı kargo
✔Ödemeler banka hesabına eft havale
✔İletişim ve bilgi için DM ve ☎0 536 562 50 96

#kazdaglari #followforlike #followalways #food #instafood #bal #köy #kazdağları #saglikliyasiyoruz #elmasirkesi #lezzet #kazdağlarından #bal #instagood #instaturkey #foodpics #ig_great_pics #keşfet #sağlıklıyaşam #like4like #foodpics #sagliklibeslenme #elhamdülillah  #lifestyle #yummy #delicious #beautiful #en #güzel
Havasıyla suyuyla cennet gibi Kazdağları. Kuzey yamaçlarındaki Yeşilköy elmalarından toplayıp kurduğumuz elma sirkelerimizin tadına şaşıracaksınız. Afiyet şifa olsun. . . ❌Kapıda ödeme yok ✔Türkiyenin heryerine anlaşmalı kargo ✔Ödemeler banka hesabına eft havale ✔İletişim ve bilgi için DM ve ☎0 536 562 50 96 #kazdaglari  #followforlike  #followalways  #food  #instafood  #bal  #köy  #kazdağları  #saglikliyasiyoruz  #elmasirkesi  #lezzet  #kazdağlarından  #bal  #instagood  #instaturkey  #foodpics  #ig_great_pics  #keşfet  #sağlıklıyaşam  #like4like  #foodpics  #sagliklibeslenme  #elhamdülillah  #lifestyle  #yummy  #delicious  #beautiful  #en  #güzel 
Good morning! 🌞 Günaydın ~
What a hot summer in the UK for a change. Starting my day with this delicious cold green smoothie.💚
☆Frozen bananas🍌
☆Mixed greens (spinach, water cress, rocket)🌱
☆Avocado 🥑
☆Almond mylk (cold)
☆2 tsp Aronia berry powder
☆Pinc of sea salt
I haven't measured anything, made 3 glasses full for my children and I.💕 Have a lovely weekend everyone!
~
Burada cok sicak biraz yaz geciriyoruz. Cok rastlanan birsey degil bu arada.🌞 O yuzden güne boyle saglikli soguk bir seyle baslamayi tercih ettik. ☆Donmus muz dilimleri🍌
☆Karisik yesillikler (Ispanak, su teresi, roka)🌱
☆Avokado🥑
☆Soguk süt (Ben badem sütü kullandim evde o vardi ama kaju, ceviz, yulaf sütleri de güzel olur. Su bile olur.)
☆2 tatli kasigi kuş kirazı tozu
☆Bir cimdik tuz.
Ölçüsüz yaptım, 3 kisilik. Orta boy 1 avokado var icinde, muzlar onceden buzlukta dilimli oldugu icin, saymadan koydum biraz.😄 Yesillik zaten istediginiz kadar, ben kocaman bir kase dolusu kodum.💕Herkese mutlu hafta sonlari diliyorum.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
#smoothie #almondmylk #spinach #healthychoices #healthyrecipes #drinkyourgreens #vegan #plantpower #plantfood #iamwellandgood #fit #fitspo #fitspiration #lifeisgood #yoga #kolaytarifler #sagliklitarifler #saglikliyasiyoruz #instahealth #instagram #photooftheday #foodphotography #yummy #nourish #eatclean #eathealthy #cleaneating #greenmilkshake #fitfam #happyweekend
Good morning! 🌞 Günaydın ~ What a hot summer in the UK for a change. Starting my day with this delicious cold green smoothie.💚 ☆Frozen bananas🍌 ☆Mixed greens (spinach, water cress, rocket)🌱 ☆Avocado 🥑 ☆Almond mylk (cold) ☆2 tsp Aronia berry powder ☆Pinc of sea salt I haven't measured anything, made 3 glasses full for my children and I.💕 Have a lovely weekend everyone! ~ Burada cok sicak biraz yaz geciriyoruz. Cok rastlanan birsey degil bu arada.🌞 O yuzden güne boyle saglikli soguk bir seyle baslamayi tercih ettik. ☆Donmus muz dilimleri🍌 ☆Karisik yesillikler (Ispanak, su teresi, roka)🌱 ☆Avokado🥑 ☆Soguk süt (Ben badem sütü kullandim evde o vardi ama kaju, ceviz, yulaf sütleri de güzel olur. Su bile olur.) ☆2 tatli kasigi kuş kirazı tozu ☆Bir cimdik tuz. Ölçüsüz yaptım, 3 kisilik. Orta boy 1 avokado var icinde, muzlar onceden buzlukta dilimli oldugu icin, saymadan koydum biraz.😄 Yesillik zaten istediginiz kadar, ben kocaman bir kase dolusu kodum.💕Herkese mutlu hafta sonlari diliyorum. . . . . . . . . . . . . . . . #smoothie  #almondmylk  #spinach  #healthychoices  #healthyrecipes  #drinkyourgreens  #vegan  #plantpower  #plantfood  #iamwellandgood  #fit  #fitspo  #fitspiration  #lifeisgood  #yoga  #kolaytarifler  #sagliklitarifler  #saglikliyasiyoruz  #instahealth  #instagram  #photooftheday  #foodphotography  #yummy  #nourish  #eatclean  #eathealthy  #cleaneating  #greenmilkshake  #fitfam  #happyweekend 
#Repost @eatvefit with @get_repost
・・・
6.07.2018 saat ⏰ 10.30
Pofuduk omletim ve arkadaşlarından günaydın herkese🌞
🌻Omlet için yumurtanın akları ve sarısı ayrı ayrı çırpılıp karıştırılıyor..kapak kapatıp buharda pişiriyorum..
Yandaşları kaymak,fıstık ezmesi(@bellanutpeanutbutter),haşhaş ezmesi,şekersiz çilek reçeli,çam fıstığı ve doğal kayısı..
~~~~~~~~~~~~~~~~~~~~~
#ketojenikdiyet #ketojenikbeslenme #ketofriendly #ketogenicdiet #ketogenicliving #eatfatlosefat #ketodiet #lchflifestyle #nasılbeslenmeliyim #saglikliyiz #saglikliyasiyoruz #nasilkiloveririm #fitnessfoods #dieting #frühstück #breakfasttime #healthybreakfast #lowcarbbreakfast #ketobreakfast #igersfood #lowcarbhighfat #fittabak #ketogeniclife #temizbeslenme #eatfatlosefat #eatfatburnfat #flexibledieting#nogluten #anticandida #ifitfitsyourmacros
#Repost  @eatvefit with @get_repost ・・・ 6.07.2018 saat ⏰ 10.30 Pofuduk omletim ve arkadaşlarından günaydın herkese🌞 🌻Omlet için yumurtanın akları ve sarısı ayrı ayrı çırpılıp karıştırılıyor..kapak kapatıp buharda pişiriyorum.. Yandaşları kaymak,fıstık ezmesi(@bellanutpeanutbutter),haşhaş ezmesi,şekersiz çilek reçeli,çam fıstığı ve doğal kayısı.. ~~~~~~~~~~~~~~~~~~~~~ #ketojenikdiyet  #ketojenikbeslenme  #ketofriendly  #ketogenicdiet  #ketogenicliving  #eatfatlosefat  #ketodiet  #lchflifestyle  #nasılbeslenmeliyim  #saglikliyiz  #saglikliyasiyoruz  #nasilkiloveririm  #fitnessfoods  #dieting  #frühstück  #breakfasttime  #healthybreakfast  #lowcarbbreakfast  #ketobreakfast  #igersfood  #lowcarbhighfat  #fittabak  #ketogeniclife  #temizbeslenme  #eatfatlosefat  #eatfatburnfat  #flexibledieting #nogluten  #anticandida  #ifitfitsyourmacros 
Hem bana hem sizlere motivasyon olsun🤗 iki foto arasında sanırım 10-12 kg var. Yıllar geçiyor hem mutsuzsun, hep takıntılısın, herkesle kendini kıyaslıyorsun. Ama bişey yapmıyorsun, mutsuz olmaya devam ediyorsun😏 Mutlu olmak senin de hakkın, bak herkes yapıyor başarıyor sen niye yapamayasın, neyin eksik☺️ unutma istersen yaparsın, yaparız vesselam. .
.
.
.
.
#diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
Hem bana hem sizlere motivasyon olsun🤗 iki foto arasında sanırım 10-12 kg var. Yıllar geçiyor hem mutsuzsun, hep takıntılısın, herkesle kendini kıyaslıyorsun. Ama bişey yapmıyorsun, mutsuz olmaya devam ediyorsun😏 Mutlu olmak senin de hakkın, bak herkes yapıyor başarıyor sen niye yapamayasın, neyin eksik☺️ unutma istersen yaparsın, yaparız vesselam. . . . . . #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+Salatalık+Domates+2 adet Acı Yeşik Biber,1 adet Yeşil Biber+Zeytin+Kekik)
. Zeytinyağlı Biber ve Zeytinnyağlı Kabak
. @icim Yoğurt 150 gram + Keten Tohumu
.ilave olarak Karpuz , 10 tane Erik ve 10 tane çiğ yeşil Fındık
.
#aksamyemegi#dinner#saglik#yogurt#kabak#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#karpuz#çobansalata#ketentohumu#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#kabakyemeği#biber#sagliklibesleniyoruz#salad#beforeafter#erik
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+Salatalık+Domates+2 adet Acı Yeşik Biber,1 adet Yeşil Biber+Zeytin+Kekik) . Zeytinyağlı Biber ve Zeytinnyağlı Kabak . @icim Yoğurt 150 gram + Keten Tohumu .ilave olarak Karpuz , 10 tane Erik ve 10 tane çiğ yeşil Fındık . #aksamyemegi #dinner #saglik #yogurt #kabak #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #karpuz #çobansalata #ketentohumu #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #kabakyemeği #biber #sagliklibesleniyoruz #salad #beforeafter #erik 
Kabaklar bu sene cok lezzetli,koylulerden aldigimdan herhalde  cesitli sekillerde tuketiyoruz bol bol.Kabaklari  soyacagin serit kismiyla soyiyorsunuz icine dereotu ve sizma zeytinyagi,tuz katip karistiriyorsunuz,uzerine sarimsakli yogurt,dovulmus cevizi tereyaginda kirmizi biberle cevirttirip uzerine dokuyorsunuz.*Yapimi 10dk suruyor,kabaklar bitmeden bol bol tuketin.#kabaksalatasi#kabaklimezeler#kabakliyogurt#mezeler#lezzetlimezeler#kabaklama#saglikliyasiyoruz#sagligimizicin#glutensiztarifler#sebzelitarifler#
Kabaklar bu sene cok lezzetli,koylulerden aldigimdan herhalde cesitli sekillerde tuketiyoruz bol bol.Kabaklari soyacagin serit kismiyla soyiyorsunuz icine dereotu ve sizma zeytinyagi,tuz katip karistiriyorsunuz,uzerine sarimsakli yogurt,dovulmus cevizi tereyaginda kirmizi biberle cevirttirip uzerine dokuyorsunuz.*Yapimi 10dk suruyor,kabaklar bitmeden bol bol tuketin.#kabaksalatasi #kabaklimezeler #kabakliyogurt #mezeler #lezzetlimezeler #kabaklama #saglikliyasiyoruz #sagligimizicin #glutensiztarifler #sebzelitarifler #
6.07.2018 saat ⏰ 10.30
Pofuduk omletim ve arkadaşlarından günaydın herkese🌞
🌻Omlet için yumurtanın akları ve sarısı ayrı ayrı çırpılıp karıştırılıyor..kapak kapatıp buharda pişiriyorum..
Yandaşları kaymak,fıstık ezmesi(@bellanutpeanutbutter),haşhaş ezmesi,şekersiz çilek reçeli,çam fıstığı ve doğal kayısı..
~~~~~~~~~~~~~~~~~~~~~
#ketojenikdiyet #ketojenikbeslenme #ketofriendly #ketogenicdiet #ketogenicliving #eatfatlosefat #ketodiet #lchflifestyle #nasılbeslenmeliyim #saglikliyiz #saglikliyasiyoruz #nasilkiloveririm #fitnessfoods #dieting #frühstück #breakfasttime #healthybreakfast #lowcarbbreakfast #ketobreakfast #igersfood #lowcarbhighfat #fittabak #ketogeniclife #temizbeslenme #eatfatlosefat #eatfatburnfat #flexibledieting#nogluten #anticandida #ifitfitsyourmacros
6.07.2018 saat ⏰ 10.30 Pofuduk omletim ve arkadaşlarından günaydın herkese🌞 🌻Omlet için yumurtanın akları ve sarısı ayrı ayrı çırpılıp karıştırılıyor..kapak kapatıp buharda pişiriyorum.. Yandaşları kaymak,fıstık ezmesi(@bellanutpeanutbutter),haşhaş ezmesi,şekersiz çilek reçeli,çam fıstığı ve doğal kayısı.. ~~~~~~~~~~~~~~~~~~~~~ #ketojenikdiyet  #ketojenikbeslenme  #ketofriendly  #ketogenicdiet  #ketogenicliving  #eatfatlosefat  #ketodiet  #lchflifestyle  #nasılbeslenmeliyim  #saglikliyiz  #saglikliyasiyoruz  #nasilkiloveririm  #fitnessfoods  #dieting  #frühstück  #breakfasttime  #healthybreakfast  #lowcarbbreakfast  #ketobreakfast  #igersfood  #lowcarbhighfat  #fittabak  #ketogeniclife  #temizbeslenme  #eatfatlosefat  #eatfatburnfat  #flexibledieting #nogluten  #anticandida  #ifitfitsyourmacros 
💞💞💞 Akşam yemeğinde kabak,  1 tavuk burger, 1 dilim ekmek 2 kaşık yoğurt. Biraz abarttım galiba.şekersiz 4. Gün. .
.
.
.
.
#şekersiz21gün #diyetteyiz #diyet #saglikliyasam #saglikspor #fitanne #fitness #zayiflama #zayifliyoruz #diyetyapiyoruz #saglikliyasiyoruz #hepberaberzayıflıyoruz #sporveyasam #sport #loseweight #healthandlife #healthlife #fatandfit 
#dinner #dinnertime #lunch #brunch #lunchtime #breakfast #breakfasttime #haltyfood #food
💞💞💞 Akşam yemeğinde kabak, 1 tavuk burger, 1 dilim ekmek 2 kaşık yoğurt. Biraz abarttım galiba.şekersiz 4. Gün. . . . . . #şekersiz21gün  #diyetteyiz  #diyet  #saglikliyasam  #saglikspor  #fitanne  #fitness  #zayiflama  #zayifliyoruz  #diyetyapiyoruz  #saglikliyasiyoruz  #hepberaberzayıflıyoruz  #sporveyasam  #sport  #loseweight  #healthandlife  #healthlife  #fatandfit  #dinner  #dinnertime  #lunch  #brunch  #lunchtime  #breakfast  #breakfasttime  #haltyfood  #food 
Kendi kefirimi kendim mayalamıştım ve kıvamıııı tadııı kokusuuu herşeyi çok  güzel olmuş .
Bayıldımmmmmm❤❤❤❤ Kendi Kefirini Mayalamaya Ne dersin ?
Ben işin kokayına kaçıp Toz Maya kullanıyorum.
1 gramlık 1 toz ve 1 litre ile 3 litre arası sütü mayalamak için kullanılıyor.
1 litre süt de kullansanız paketün tamamını 3 litre kullansanız da paketin tamamını döküyorsunuz.
@sokmarketler 'de buzdolabında @yaylamaya kefir bulabilirsiniz.Çok uygun bir fiyatı var yalan olmasın 1.5 veya 1.9 ₺ arasında bir şey.
Ben köy sütü kullanıyorum siz günlük sütte kullanabilirsiniz. Hazır süt ile hiç denemedim.
Sütünüzü kaynatıyorsunuz . Ilımaya bırakıp ısı kontrolü yapıyoruz. 7 ye kadar elimiz yanmadan durabilirse parmağınız mayalanma ısısna gelmiş demektir.
İsterseniz tencerede mayalayın isterseniz şişe de benim şişeyi dolapta muhafaza etmem daha kolay oluyor o yüzden şişe tercih ediyorum. Sütü şişeye doldurup mayayı az bir süte katıp onuda şişeye koyuyorum ağızlarını kapatıp güzelceee çalkalıyorum ve  sofra bezine güzelce sarıp ardından battaniyeye sarıyorum.Hiç kıpırdamayacak bir köşeye koyuyorum ve saate bakıyorum . Mesela 13.00'da bitirdim işlemi 24 saat sonra yani yarın saat 13'te açıp çalkakıyacağım ve doğru dolaba kaldıracağım 1 gün dolapta bekledikten sonra tüketilmeye hazır olmuş olacak. 💃
Afiyet olsun ❤

#kefir#kefiryapimi#kefirmayasi#kefirmayalama#maya#mayalama#yaylamaya#şok#şokmarketler#probiyotik#süt#sütmayalama#günlüksüt#köysütü#ineksütü#milk#drink#saglik#laktoz#bakteri#sagliklibeslen#saglikliyasiyoruz#saglikicin#nogluten#nosugar#glutenfree#laktozsuz#healthy#health#diet
Kendi kefirimi kendim mayalamıştım ve kıvamıııı tadııı kokusuuu herşeyi çok güzel olmuş . Bayıldımmmmmm❤❤❤❤ Kendi Kefirini Mayalamaya Ne dersin ? Ben işin kokayına kaçıp Toz Maya kullanıyorum. 1 gramlık 1 toz ve 1 litre ile 3 litre arası sütü mayalamak için kullanılıyor. 1 litre süt de kullansanız paketün tamamını 3 litre kullansanız da paketin tamamını döküyorsunuz. @sokmarketler 'de buzdolabında @yaylamaya kefir bulabilirsiniz.Çok uygun bir fiyatı var yalan olmasın 1.5 veya 1.9 ₺ arasında bir şey. Ben köy sütü kullanıyorum siz günlük sütte kullanabilirsiniz. Hazır süt ile hiç denemedim. Sütünüzü kaynatıyorsunuz . Ilımaya bırakıp ısı kontrolü yapıyoruz. 7 ye kadar elimiz yanmadan durabilirse parmağınız mayalanma ısısna gelmiş demektir. İsterseniz tencerede mayalayın isterseniz şişe de benim şişeyi dolapta muhafaza etmem daha kolay oluyor o yüzden şişe tercih ediyorum. Sütü şişeye doldurup mayayı az bir süte katıp onuda şişeye koyuyorum ağızlarını kapatıp güzelceee çalkalıyorum ve sofra bezine güzelce sarıp ardından battaniyeye sarıyorum.Hiç kıpırdamayacak bir köşeye koyuyorum ve saate bakıyorum . Mesela 13.00'da bitirdim işlemi 24 saat sonra yani yarın saat 13'te açıp çalkakıyacağım ve doğru dolaba kaldıracağım 1 gün dolapta bekledikten sonra tüketilmeye hazır olmuş olacak. 💃 Afiyet olsun ❤ #kefir #kefiryapimi #kefirmayasi #kefirmayalama #maya #mayalama #yaylamaya #şok #şokmarketler #probiyotik #süt #sütmayalama #günlüksüt #köysütü #ineksütü #milk #drink #saglik #laktoz #bakteri #sagliklibeslen #saglikliyasiyoruz #saglikicin #nogluten #nosugar #glutenfree #laktozsuz #healthy #health #diet 
Akşam Yemeğim🍴
19.00⌚
.
Herkese Mutlu Akşamlar🍀
Annem dün akşam dahil olmak üzere 3 akşamlık Biber Dolması ve Kabak Dolması yemeği yapmış.
Dün akşam yememiştim bu akşam da yemedim.
Kendime Peynirli ve Yeşil Mercimekli Kabak dolması yaptım.
.

Tabağımdakiler;
. Salata (Zeytinyağı+Limon Suyu+Salatalık+Domates+2 adet Acı Yeşil Biber,1 adet Yeşil Biber+Zeytin+Kekik)
.Pirinçli Kabak Yemeği
. @icim Yoğurt 150 gram + Keten Tohumu
. Peynirli Yeşil Mercimekli Kabak Dolması
.250 ml Kefir + Zeytinyağı , Zerdeçal ve Karabiber
( Kefirim enfes olmuş kıvamı ayrandan daha daha koyu olmuş resmen içine salatalık doğra ya da semiz otu koy kaşık kaşık ye bir dahaki gönderide kıvamının videosunu paylaşıcam ❤).
.
Peynirli Yeşil Mercimekli Kabak Dolması Tarifi💃
Haşlanmış yeşil mercimeği , @icim Beyaz Peyniri , dilediğiniz baharat tuz ve zeytinnyağını tavada peynir eriyene kadar çevirin.
İçini oyup başladığınız kabağın içine doldurun ve isterseniz üzerine salçalı sos ilave edin.
Afiyet olsun 💐
.
#aksamyemegi#dinner#saglik#yogurt#kabak#diyet#saglikliyasiyoruz#protein#lowcarb#sunum#tarif#nosugar#motivation#sekersizbeslenme#kefir#çobansalata#ketentohumu#karatay#keto#sekersiz21gun#diyethesaplaritakiplesiyor#karataybeslenmesi#sekersizbesleniyoruz#sağlıklıbeslenme#kabakyemeği#probiyotik#sagliklibesleniyoruz#glutensizkabakdolması#beforeafter#glutensiz
Akşam Yemeğim🍴 19.00⌚ . Herkese Mutlu Akşamlar🍀 Annem dün akşam dahil olmak üzere 3 akşamlık Biber Dolması ve Kabak Dolması yemeği yapmış. Dün akşam yememiştim bu akşam da yemedim. Kendime Peynirli ve Yeşil Mercimekli Kabak dolması yaptım. . Tabağımdakiler; . Salata (Zeytinyağı+Limon Suyu+Salatalık+Domates+2 adet Acı Yeşil Biber,1 adet Yeşil Biber+Zeytin+Kekik) .Pirinçli Kabak Yemeği . @icim Yoğurt 150 gram + Keten Tohumu . Peynirli Yeşil Mercimekli Kabak Dolması .250 ml Kefir + Zeytinyağı , Zerdeçal ve Karabiber ( Kefirim enfes olmuş kıvamı ayrandan daha daha koyu olmuş resmen içine salatalık doğra ya da semiz otu koy kaşık kaşık ye bir dahaki gönderide kıvamının videosunu paylaşıcam ❤). . Peynirli Yeşil Mercimekli Kabak Dolması Tarifi💃 Haşlanmış yeşil mercimeği , @icim Beyaz Peyniri , dilediğiniz baharat tuz ve zeytinnyağını tavada peynir eriyene kadar çevirin. İçini oyup başladığınız kabağın içine doldurun ve isterseniz üzerine salçalı sos ilave edin. Afiyet olsun 💐 . #aksamyemegi #dinner #saglik #yogurt #kabak #diyet #saglikliyasiyoruz #protein #lowcarb #sunum #tarif #nosugar #motivation #sekersizbeslenme #kefir #çobansalata #ketentohumu #karatay #keto #sekersiz21gun #diyethesaplaritakiplesiyor #karataybeslenmesi #sekersizbesleniyoruz #sağlıklıbeslenme #kabakyemeği #probiyotik #sagliklibesleniyoruz #glutensizkabakdolması #beforeafter #glutensiz 
Geçen gün yediğimiz tava yemeğine özenip evde ufak bir deneme yaptım..
🍗Kuşbaşı dana eti,kuru soğan,biber,domates ve sarımsak satırla inceltildi ve bol baharat ve kuyruk yağı ilavesiyle odun fırınına gönderildi..sonuç olmuşş😊👌ben bu işi biliyorum,mütevazi olamicam😂😂🏆🎯
~~~~~~~~~~~~~~~~~~~
#ketojenikdiyet #eatfatlosefat #hflclife #anticandida #nasılbeslenmeliyim #fitnessfoods #dieting #fitnessmotivation #worldfoods #cheflife #foodporn #ketoif #eatfatburnfat #sagliklibeslenme #sagliklihayat #healtylife #diyetkardesligi #saglikliyiz #saglikliyasiyoruz #nasilkiloveririm #diyetsizkiloverme #diyetsizyasam #temizyasam #healtyfood #cleaneats #lowcarbdinner #dietdiary #igersfood #instafood #foodlovers
Geçen gün yediğimiz tava yemeğine özenip evde ufak bir deneme yaptım.. 🍗Kuşbaşı dana eti,kuru soğan,biber,domates ve sarımsak satırla inceltildi ve bol baharat ve kuyruk yağı ilavesiyle odun fırınına gönderildi..sonuç olmuşş😊👌ben bu işi biliyorum,mütevazi olamicam😂😂🏆🎯 ~~~~~~~~~~~~~~~~~~~ #ketojenikdiyet  #eatfatlosefat  #hflclife  #anticandida  #nasılbeslenmeliyim  #fitnessfoods  #dieting  #fitnessmotivation  #worldfoods  #cheflife  #foodporn  #ketoif  #eatfatburnfat  #sagliklibeslenme  #sagliklihayat  #healtylife  #diyetkardesligi  #saglikliyiz  #saglikliyasiyoruz  #nasilkiloveririm  #diyetsizkiloverme  #diyetsizyasam  #temizyasam  #healtyfood  #cleaneats  #lowcarbdinner  #dietdiary  #igersfood  #instafood  #foodlovers 
Merhaba! Sıradaki versus biraz çetin olsun diye çikolata ailesinin biraz hor görülen üyesi bitteri seçtim. Sütlü bir çikolataya karşı bizim kuru hurmanın pek şansı olmazdı, öyle değil mi? 
Siz yine de bakmayın onun öyle kuru filan göründüğüne... Bir köşede sevilmeyen evlat bitter, diğer köşede zor tatlı krizlerinin kahramanı hurma. Bakalım neler olacak?🤓🤔 Öncelikle ikisi için de 15 gram alıyorum- 15 gram ortalama bir kuru hurmanın ağırlığıdır. Hurma ilk golü burada atıyor,  15 gram kuru hurma 42 kaloriyken aynı miktardaki bitter çikolata 72 kaloridir. Karbonhidrat miktarı ise kuru hurmada 11 gramken bitter çikolatada 7 gram; durum eşitlendi gibi. Kuru hurmada yağ yok diyebiliriz oysa ki bitter çikolata 4.5 gram yağ içermekte. Keza hurmanın potasyum oranı 104 miligram ile bitterin iki katı kadar fazla. Öncelikle ikisinin de şeker içeriği fazla öyle diyeyim. Fakat bu versusta hurmayı daha avantajlı yapan şey yağ içeriğine sahip olmamasından ötürü kalorisinin az olması. Bitter çikolatayı daha avantajlı yapan şey ise yüksek yağ içermesinden dolayı bir sonraki tatlı krizini veya kan şekerini daha yavaş düşürmesi. Bir ara öğünde, sütlü bir kahvenin yanında dönüşümlü olarak tüketilebilecek bir ikili diyelim ve barışı sağlayalım o halde :) 😊😇🤓 #hurma #bitter #diyetisyen #diyet #diyettarifleri #diyetteyim #diyetkardesligi #dietitician #saglik #sagliklitabaklar #saglikliyasam #sagliklibeslenme #saglikliyasiyoruz #sagliklikiloalma
Merhaba! Sıradaki versus biraz çetin olsun diye çikolata ailesinin biraz hor görülen üyesi bitteri seçtim. Sütlü bir çikolataya karşı bizim kuru hurmanın pek şansı olmazdı, öyle değil mi? Siz yine de bakmayın onun öyle kuru filan göründüğüne... Bir köşede sevilmeyen evlat bitter, diğer köşede zor tatlı krizlerinin kahramanı hurma. Bakalım neler olacak?🤓🤔 Öncelikle ikisi için de 15 gram alıyorum- 15 gram ortalama bir kuru hurmanın ağırlığıdır. Hurma ilk golü burada atıyor, 15 gram kuru hurma 42 kaloriyken aynı miktardaki bitter çikolata 72 kaloridir. Karbonhidrat miktarı ise kuru hurmada 11 gramken bitter çikolatada 7 gram; durum eşitlendi gibi. Kuru hurmada yağ yok diyebiliriz oysa ki bitter çikolata 4.5 gram yağ içermekte. Keza hurmanın potasyum oranı 104 miligram ile bitterin iki katı kadar fazla. Öncelikle ikisinin de şeker içeriği fazla öyle diyeyim. Fakat bu versusta hurmayı daha avantajlı yapan şey yağ içeriğine sahip olmamasından ötürü kalorisinin az olması. Bitter çikolatayı daha avantajlı yapan şey ise yüksek yağ içermesinden dolayı bir sonraki tatlı krizini veya kan şekerini daha yavaş düşürmesi. Bir ara öğünde, sütlü bir kahvenin yanında dönüşümlü olarak tüketilebilecek bir ikili diyelim ve barışı sağlayalım o halde :) 😊😇🤓 #hurma  #bitter  #diyetisyen  #diyet  #diyettarifleri  #diyetteyim  #diyetkardesligi  #dietitician  #saglik  #sagliklitabaklar  #saglikliyasam  #sagliklibeslenme  #saglikliyasiyoruz  #sagliklikiloalma 
ŞEKERSIZ,UNSUZ KEK.Cocuklariniza seker,un yedirmeyin lutfen,arabsira boyle kekler yaparsaniz,damak tadi saglikli gidalara alisinca zaten kotu gida bunyesi istemez,usenmeyin yapin.Evinizde bulunan malzemelerle de yapabilirsiniz.Tarifine gelince,2olgun muz,3 yumurta,pirincunu,cekilmis ceviz ve findik,5adet hurma,yarim su bardagi cekilmis kuru dut,6,7 adet kuru kan uzumu,2adet kuru kayisi,yarim avuc  kuru yaban mersini,1dolu cay kasigi sirkeyle kabartilmis karbonat,istenilen miktarda tarcin.muzlari catalla ezin,yumurtalari icine koyup mikserle cirpin,diger malzemelri icine ilave edin,kivami yogurt gibi olana kadar da piricunu ilave edin ve firina .Cok lezzetli oldu,deneyenler haber versin:) #şekersizkek#sekersizlezzetler#sekersiztatlilar#glutensiztarifler#unsuzkekler#glutensiztatlilar#saglikliatistirmaliklar#cocuklarherseyimiz#bombakek#saglikliyasiyoruz#sekersizdunya#enfestatlar#gurmetarifler#glutensizyasiyoruz#
ŞEKERSIZ,UNSUZ KEK.Cocuklariniza seker,un yedirmeyin lutfen,arabsira boyle kekler yaparsaniz,damak tadi saglikli gidalara alisinca zaten kotu gida bunyesi istemez,usenmeyin yapin.Evinizde bulunan malzemelerle de yapabilirsiniz.Tarifine gelince,2olgun muz,3 yumurta,pirincunu,cekilmis ceviz ve findik,5adet hurma,yarim su bardagi cekilmis kuru dut,6,7 adet kuru kan uzumu,2adet kuru kayisi,yarim avuc kuru yaban mersini,1dolu cay kasigi sirkeyle kabartilmis karbonat,istenilen miktarda tarcin.muzlari catalla ezin,yumurtalari icine koyup mikserle cirpin,diger malzemelri icine ilave edin,kivami yogurt gibi olana kadar da piricunu ilave edin ve firina .Cok lezzetli oldu,deneyenler haber versin:) #şekersizkek #sekersizlezzetler #sekersiztatlilar #glutensiztarifler #unsuzkekler #glutensiztatlilar #saglikliatistirmaliklar #cocuklarherseyimiz #bombakek #saglikliyasiyoruz #sekersizdunya #enfestatlar #gurmetarifler #glutensizyasiyoruz #
Aksam yemegimmm ^-^ 2 tane küçük bulgurlu firikli dolma ve bir kase yoğurt herkesee afiyet olsun♡♥
Aksam yemegimmm ^-^ 2 tane küçük bulgurlu firikli dolma ve bir kase yoğurt herkesee afiyet olsun♡♥