an online Instagram web viewer

#muna medias

Photos

Celana Cargo Black size 39-44 bahan katun twill ( best seller) Harga Rp.175.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami #onlineshop #carierreseller #firsthand #original #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #celanapanjang #kemejakantor #kendarikeren #baubau #flanel #distrokendari #malmo #imprensif
Celana cargo Dark Greysize 39-44 bahan katun twill ( best seller) Harga Rp.175.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami #onlineshop #carierreseller #firsthand #original #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #celanapanjang #kemejakantor #kendarikeren #baubau #flanel #distrokendari #malmo #imprensif
Kelakuan nya itu loh mbak😄
Pengen ketawa tapi takut dosa:v
Anda menyindir saya? sempurna kan diri mu terlebih dahulu....Muka anda seberapa cantik?seberapa sempurna kah anda?
UpS:V😌
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
#sindirankeras #sindiranteman #katasindiran #sindiranbanget 
#temansekolah #munafieoriginal #temanggunghits #temanseperjuangan 
#like4comment #liked #followersaktifindo #followmenow #followmee #followgram #liker #munafik #teman #temanmunafik #munakata #muna #munaluchibride 
#kawankawan #quotessindiran #bajinganberkelas
Kelakuan nya itu loh mbak😄 Pengen ketawa tapi takut dosa:v Anda menyindir saya? sempurna kan diri mu terlebih dahulu....Muka anda seberapa cantik?seberapa sempurna kah anda? UpS:V😌 - - - - - - - - - - - - - - - - - - - - - - - - - - - - #sindirankeras  #sindiranteman  #katasindiran  #sindiranbanget  #temansekolah  #munafieoriginal  #temanggunghits  #temanseperjuangan  #like4comment  #liked  #followersaktifindo  #followmenow  #followmee  #followgram  #liker  #munafik  #teman  #temanmunafik  #munakata  #muna  #munaluchibride  #kawankawan  #quotessindiran  #bajinganberkelas 
Друзья, вчера в нашей студии прошли съемки @zahrabadalbayli и ее творческой группы. Ожидается что-то очень интересное! Спасибо, что выбрали нас!♥️
Наша площадка идеально подходит для персональных и групповых выставок (фотовыставок), инсталляций, перформансов и пр.
- возможность аренды помещения под стенд (выставочный зал площадью 90 м2, вмещающий 100 картин);
- отличное освещение;
- монтаж и демонтаж экспозиций;
- торжественное оформление и открытие выставки;
- фуршет;
- организация ведущего (вступительное слово, презентация содержания выставки, представление участников выставки).
Детально проведение мероприятия обговаривается с заказчиком с учетом его пожеланий.
Телефоны для связи:
📞(+99455) 350 07 77;
📞(+99450) 345 57 15;
📞(+99412) 436 89 52
📍Mirza Fatali Axundov, 164 (бывш 6ая Параллельная, вблизи Фаворит маркета)
#cloudsbymuna #exhibition #muna #gallery #artschool #art #artwork #baku #azerbaijan
Друзья, вчера в нашей студии прошли съемки @zahrabadalbayli и ее творческой группы. Ожидается что-то очень интересное! Спасибо, что выбрали нас!♥️ Наша площадка идеально подходит для персональных и групповых выставок (фотовыставок), инсталляций, перформансов и пр. - возможность аренды помещения под стенд (выставочный зал площадью 90 м2, вмещающий 100 картин); - отличное освещение; - монтаж и демонтаж экспозиций; - торжественное оформление и открытие выставки; - фуршет; - организация ведущего (вступительное слово, презентация содержания выставки, представление участников выставки). Детально проведение мероприятия обговаривается с заказчиком с учетом его пожеланий. Телефоны для связи: 📞(+99455) 350 07 77; 📞(+99450) 345 57 15; 📞(+99412) 436 89 52 📍Mirza Fatali Axundov, 164 (бывш 6ая Параллельная, вблизи Фаворит маркета) #cloudsbymuna  #exhibition  #muna  #gallery  #artschool  #art  #artwork  #baku  #azerbaijan 
Abu Fareedah Reporting From Muna For ENARRATE TV.

Subscribe to ENARRATE TV on YouTube to see upcoming interviews, discovery hajj within, The Haraman tour - the 2 holy mosques, the market and more.

Download ENARRATE free on Play store,  Apple store,  Microsoft store to watch directly on our app,  listen to ENRADIO, access your social media accounts, browse our website and enjoy the unlimited possibilities of our app. Kindly send us feedback on WHATSAPP +2349098057895 or email projects@enarrate.com 
#en #enarrate #islam #muna #arafat #jamarat #musdalifa #muslim #hijab #quran
Abu Fareedah Reporting From Muna For ENARRATE TV. Subscribe to ENARRATE TV on YouTube to see upcoming interviews, discovery hajj within, The Haraman tour - the 2 holy mosques, the market and more. Download ENARRATE free on Play store, Apple store, Microsoft store to watch directly on our app, listen to ENRADIO, access your social media accounts, browse our website and enjoy the unlimited possibilities of our app. Kindly send us feedback on WHATSAPP +2349098057895 or email projects@enarrate.com #en  #enarrate  #islam  #muna  #arafat  #jamarat  #musdalifa  #muslim  #hijab  #quran 
Abu Fareedah Reporting From Muna For ENARRATE TV.

Subscribe to ENARRATE TV on YouTube to see upcoming interviews, discovery hajj within, The Haraman tour - the 2 holy mosques, the market and more.

Download ENARRATE free on Play store,  Apple store,  Microsoft store to watch directly on our app,  listen to ENRADIO, access your social media accounts, browse our website and enjoy the unlimited possibilities of our app. Kindly send us feedback on WHATSAPP +2349098057895 or email projects@enarrate.com 
#en #enarrate #islam #muna #arafat #jamarat #musdalifa #muslim #hijab #quran.
Abu Fareedah Reporting From Muna For ENARRATE TV. Subscribe to ENARRATE TV on YouTube to see upcoming interviews, discovery hajj within, The Haraman tour - the 2 holy mosques, the market and more. Download ENARRATE free on Play store, Apple store, Microsoft store to watch directly on our app, listen to ENRADIO, access your social media accounts, browse our website and enjoy the unlimited possibilities of our app. Kindly send us feedback on WHATSAPP +2349098057895 or email projects@enarrate.com #en  #enarrate  #islam  #muna  #arafat  #jamarat  #musdalifa  #muslim  #hijab  #quran .
Abu Fareedah Reporting From Muna For ENARRATE TV.

Subscribe to ENARRATE TV on YouTube to see upcoming interviews, discovery hajj within, The Haraman tour - the 2 holy mosques.

#en #enarrate #islam #muna #arafat #jamarat #musdalifa #muslim #hijab #quran
ENARRATE Live @ Muna!

Muna is receiving the Hujjaj today, the right start tomorrow however,  this camp is a great test for the Hujjaj cos diff people sleep side by side on a single-side mattress on the floor. May Allaah subhanahu wa ta'la overlook our shortcomings and accept our hajj. Aamiyn 
#hajj #hajj2018 #muna #hujjaj #arafat #musdalifa #jamarat #islam #hajjrite #day1 #muslim #muslimah #makkah #tawaf
Sunnuntain lettuaamiaisesta en luovu ❤️ Manteliletut vol. 1 🥞 Resepti kaipaa vielä hieman hiomista, maku on hieman liian... munainen 😅 #elämäntapamuutos #muna #manteliletut #sunnuntai #sundaymorning #leaninfiveweekschallenge #LIFWelokuu2018
Regrann from @labengki_nirwana_resort - 
Pulau Labengki ini terletak di Propinsi Sulawesi Tenggara dan keindahanya tidak kalah dengan Wakatobi ataupun Raja Ampat yang sudah begitu terkenal. Kenapa banyak yang menyebut Pulau Labengki sebagai Raja Ampatnya Suluwesi karena destinasi ini bernuansa hampir sama dengan Raja Ampat yang terdiri dari karang-karang besar yang menjelang diatas samudera diberbagai titiknya. Gugusan pulau karang besar dan kecil ini dipetakan menjadi Pulau Labengki Besar dan Pulau Labengki Kecil.

Lokasi
Pulau Labengki secara administratif masuk ke dalam wilayah Kabupaten Konawe Utara, Provinsi Sulawesi Tenggara. ×
×
_________________________
#expolresulawesi_tenggara
#expolresouthsulawesi
#expolreindonesia
#wisatasultra
-
#bombana #buton#kendari#butonselatan #baubau #butontengah #muna #kolaka
#butonutara #kolakatimur #kolakautara #konawe #konawekepulauan
#konaweselatan #konaweutara
#munabarat #wakatobi
Regrann from @labengki_nirwana_resort - Pulau Labengki ini terletak di Propinsi Sulawesi Tenggara dan keindahanya tidak kalah dengan Wakatobi ataupun Raja Ampat yang sudah begitu terkenal. Kenapa banyak yang menyebut Pulau Labengki sebagai Raja Ampatnya Suluwesi karena destinasi ini bernuansa hampir sama dengan Raja Ampat yang terdiri dari karang-karang besar yang menjelang diatas samudera diberbagai titiknya. Gugusan pulau karang besar dan kecil ini dipetakan menjadi Pulau Labengki Besar dan Pulau Labengki Kecil. Lokasi Pulau Labengki secara administratif masuk ke dalam wilayah Kabupaten Konawe Utara, Provinsi Sulawesi Tenggara. × × _________________________ #expolresulawesi_tenggara  #expolresouthsulawesi  #expolreindonesia  #wisatasultra  - #bombana  #buton #kendari #butonselatan  #baubau  #butontengah  #muna  #kolaka  #butonutara  #kolakatimur  #kolakautara  #konawe  #konawekepulauan  #konaweselatan  #konaweutara  #munabarat  #wakatobi 
Sepatu kicker size 39-44( best seller) Harga Rp.230.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami #onlineshop #carierreseller #firsthand #original #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #celanapanjang #kemejakantor #kendarikeren #baubau #flanel #distrokendari #malmo #imprensif
‏اللهم البِشارات التي نُحب، والأيام التي تسر والرحمات التي تتوالى والعـافية التي ننعم بها واليقِين الذي يريح القلوب.🌱💕 ...... ..... #يوم #الترويه #الحج #makkah #muna #hajj #2018 #goodmorning #islam #saudiarabia #guten_morgen
Ketika kau sukanya ratusan bahkan ribuan mdpl, apalah dayaku yg suka O mdpl. Intinya merdeka kita merdeka. Dirgahayu Republik Indonesia, Salam dari perbatasan Muna dan Bombana 🇮🇩🇮🇩 Video taken by : @billgustom 
Loc: Desa Terapung tapi - tapi
Kec. Marobo
Kab. Muna
#maitewuna #wuna #muna #ilovesultra #merdeka #hutri73
Ketika kau sukanya ratusan bahkan ribuan mdpl, apalah dayaku yg suka O mdpl. Intinya merdeka kita merdeka. Dirgahayu Republik Indonesia, Salam dari perbatasan Muna dan Bombana 🇮🇩🇮🇩 Video taken by : @billgustom Loc: Desa Terapung tapi - tapi Kec. Marobo Kab. Muna #maitewuna  #wuna  #muna  #ilovesultra  #merdeka  #hutri73 
Celana chino size 28-34 bahan katun twill ( best seller) Harga Rp.150.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami #onlineshop #carierreseller #firsthand #original #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #celanapanjang #kemejakantor #kendarikeren #baubau #flanel #distrokendari #malmo #imprensif
Celana chino mocca size 28-34 bahan katun twill ( best seller) Harga Rp.150.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami #onlineshop #carierreseller #firsthand #original #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #celanapanjang #kemejakantor #kendarikeren #baubau #flanel #distrokendari #malmo #imprensif
Celana chino black size 28-34 bahan katun twill ( best seller) Harga Rp.150.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami #onlineshop #carierreseller #firsthand #original #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #celanapanjang #kemejakantor #kendarikeren #baubau #flanel #distrokendari #malmo #imprensif
Knp ko panik anu? Kampunganmu!😂
.
.
#justcaption#siang
#parigi#muna#sultrahits 
#lfl💛#lfl#fff#fff💋
Celana chino grey size 28-34 Harga Rp.150.000
Untuk pemesanan silakan hub BBM/WA yang tercantum di profil kami
 #onlineshop #carierreseller #firsthand #followme #onlineshopindo #belanjaonline #Raha #trustedseller #Kendari #papua #makasar #sulawesi #pontianak #tarakan #Muna #kendarikeren #kemejacowok #celana #
No hay nada mejor que tener a tu amiga dorada sacándote fotos  te amodoro mi Lu! 😍#friends  #muna #conocemexico  #iloveyucatan  #mujerespoderosas  #amigafotografa
Nah disini mimin mau memperkenalkan kekalian @fandihasib putra Sulawesi Tenggara yang bisa di ambil contoh!!! Dikutip dari @fandihasib "Sebagai Pemuda asli Sultra,yang merantau ke Jakarta,sudah menjadi kewajiban saya untuk menjaga tradisi,budaya dan kekayaan Bumi Anoa. Salah satunya tetap bersentuhan dengan kuliner Sulawesi,meskipun saya di Jakarta.Agak susah sebenarnya,tapi jadi tantangan tersendiri.

Nah kali ini ketemu Coto.Namanya memang Coto Makassar,tapi lidah orang Kendari dan beberapa Kabupaten lain di Sultra sudah sangat lekat dengan Coto,baik untuk sarapan maupun makan siang.Mungkin juga karena dahulu Sultra pernah menyatu dalam satu provinsi dengan Sulsel,maka jangan heran kalau cantik/gantengnya serta makanannya sama sama ji 😁,Ujarnya. 
Yang orang Kendari, Muna,Bombana,Unaaha, Kolaka, Bau-bau, Bombana Dll,yang suka Coto mana suaranya Koraaaannngggg? 😁

Full video di Bio, Atau langsung ke channel youtube Fandi Hasib ☺️🙏 Terima kasih 2 teman kantor yg bersedia mencoba kuliner Sulawesi @aulianurmalasaripane @nklt

#sultrainfo_ #sultrainfo #sultrainformasi #repost #Sultra #Sulawesi #Kendari #Kolaka #Baubau #Buton #Raha #Muna #Kuliner #coto #Vlog
Nah disini mimin mau memperkenalkan kekalian @fandihasib putra Sulawesi Tenggara yang bisa di ambil contoh!!! Dikutip dari @fandihasib "Sebagai Pemuda asli Sultra,yang merantau ke Jakarta,sudah menjadi kewajiban saya untuk menjaga tradisi,budaya dan kekayaan Bumi Anoa. Salah satunya tetap bersentuhan dengan kuliner Sulawesi,meskipun saya di Jakarta.Agak susah sebenarnya,tapi jadi tantangan tersendiri. Nah kali ini ketemu Coto.Namanya memang Coto Makassar,tapi lidah orang Kendari dan beberapa Kabupaten lain di Sultra sudah sangat lekat dengan Coto,baik untuk sarapan maupun makan siang.Mungkin juga karena dahulu Sultra pernah menyatu dalam satu provinsi dengan Sulsel,maka jangan heran kalau cantik/gantengnya serta makanannya sama sama ji 😁,Ujarnya. Yang orang Kendari, Muna,Bombana,Unaaha, Kolaka, Bau-bau, Bombana Dll,yang suka Coto mana suaranya Koraaaannngggg? 😁 Full video di Bio, Atau langsung ke channel youtube Fandi Hasib ☺️🙏 Terima kasih 2 teman kantor yg bersedia mencoba kuliner Sulawesi @aulianurmalasaripane @nklt #sultrainfo_  #sultrainfo  #sultrainformasi  #repost  #Sultra  #Sulawesi  #Kendari  #Kolaka  #Baubau  #Buton  #Raha  #Muna  #Kuliner  #coto  #Vlog 
MUNA💞KURUNG FANA 2.0

1 PASANG (tidak termasuk pos)
Harga : RM99

2 PASANG (tidak termasuk pos)
Harga : RM198

3 PASANG (tidak termasuk pos)
Harga : RM285

CIRI-CIRI
Material Korean crepe 
Mesra wudhuk (zip sorok di lengan)
Mesra menyusu (zip sorok di dada) *setiap pasang baju percuma 2biji Brooch
*brooch hanyalah FREEGIFT dari HQ maka  design mungkin berbeza dari gambar
*warna baju mungkin sedikit berbeza dari gambar atas faktor pencahayaan

#muna
#kurungfana2
#kurungfana
#munakurungfana
MUNA💞KURUNG FANA 2.0 1 PASANG (tidak termasuk pos) Harga : RM99 2 PASANG (tidak termasuk pos) Harga : RM198 3 PASANG (tidak termasuk pos) Harga : RM285 CIRI-CIRI Material Korean crepe Mesra wudhuk (zip sorok di lengan) Mesra menyusu (zip sorok di dada) *setiap pasang baju percuma 2biji Brooch *brooch hanyalah FREEGIFT dari HQ maka design mungkin berbeza dari gambar *warna baju mungkin sedikit berbeza dari gambar atas faktor pencahayaan #muna  #kurungfana2  #kurungfana  #munakurungfana 
"I know a place we can go
Where everyone gonna lay down their weapon
Lay down their weapon
Don't you be afraid of love and affection
Just lay down your weapon"
.
.
.
.
.
.
#muna #art #artwork #artist #saradavisart #drawing #feminine #werk #portlandartist #etsy #etsyartist #sketch #wip #workinprogress #ink #illustration #fashionillustration #graphite #dance #ballerina
🥚 - prae, keeda, pošeeri! Kõik eriti kiired võimalused kõhu täitmiseks. 🤤

PS! Valgud hoiavad kõhu kauem täis. 😏

#kokkamekoos #tervislik #toit #food #muna #valgud #maitsev #amccookware
Heldene Aeg feat. Rahel Ollisaar @hobusepats 😍🤩😋😘💖🐛👹👼🏻 #heldeneaeg #guitarsolo #hotstuff #band #wedding #namadagina #muna #kinoa #bass #drum #saxophone #trumpet
Trixajzle'bliz #BW #munaposeact'ladytime #muna #unaonlygirlwithfeatherskin/betterlooks #janiceworld2018artlooks:jvt.com
b.n.a.t.u.r.a.l.m.e.d.s.p.a 
Glowing and youthful skin is possible.

Muna ,Gets her monthly Vitamin C facial to keep her skin glowing, youthful and to fight the damaging effects of the camera lights.
#glowingskin #bnaturalmedspa #wellness #spa #bnatural #spatreatment #facials #vitamincfacial #skincare #medspa #muna
Just counting my blessings. #David #Muna #Nephew #Niece #ProudAunty
SAATNYA BUKA MATA PADA PELUANG DI DEPAN MATA 👀

Zaman sekarang dimana perekonomian banyak yg lesu, 
kita harus pandai2 membuka mata pada peluang yg hadir di sekitar kita. 
Sebenarnya peluang tidak pilih kasih,  tapi kita yg tidak peka dan membatasi diri dg prinsip klasik, "Rezeki ga kemana". Ini diartikan jika kita berdiam diri pun maka rezeki akan tiba2 datang di depan kita bahkan disuapin ke dalam mulut kita. 
Betul rezeki ga kemana, dia diam di sana menunggu dijemput pemiliknya. Ini arti pepatah "Rezeki ga kemana" versi aku.. 😄

Nah, jika kita jg diam berpangku tangan tak ada inisiatif dan keberanian utk menempuh perjalanan menjemputnya, 
emas segunung di depan mata yg ditakdirkan utk kita pun tetap hanya bisa kita nikmati dengan memandang sambil berkhayal " seandainya, seandainya, seandainya..". Dan yang lebih menyakitkan lagi, 
Tidak  lama kemudian kita melihat ada orang lain yang malah sedang mengambil dan menggotongnya.

Mungkin skenario dan peran berubah,  karena orang yg ditakdirkan jadi sang pemain utama , tidak mau menjalankan perannya .. Daripada mubazir mungkin ya.. 😄

Sama seperti makanan yg diberikan untuk kita di depan mata kita. 
Karena kita tidak berusaha memakannya , 
maka akhirnya itu jadi rezeki lalat.. Daripada mubazir..😄 Mungkin teori ini terkesan mengada2 dan sok tau atau apalah. Tapi dengan mempercayai teori ini, 
telah mengubah sikap, karakter dan hidup banyak orang.. Rezeki gak kemana,
 dia diam di sana menunggu dijemput. 
Dan jika tidak kita jemput, ada yg siap menggantikan peran kita, daripada mubazir.. 😊

#Muna Leader Kmc Azaria
SAATNYA BUKA MATA PADA PELUANG DI DEPAN MATA 👀 Zaman sekarang dimana perekonomian banyak yg lesu, kita harus pandai2 membuka mata pada peluang yg hadir di sekitar kita. Sebenarnya peluang tidak pilih kasih, tapi kita yg tidak peka dan membatasi diri dg prinsip klasik, "Rezeki ga kemana". Ini diartikan jika kita berdiam diri pun maka rezeki akan tiba2 datang di depan kita bahkan disuapin ke dalam mulut kita. Betul rezeki ga kemana, dia diam di sana menunggu dijemput pemiliknya. Ini arti pepatah "Rezeki ga kemana" versi aku.. 😄 Nah, jika kita jg diam berpangku tangan tak ada inisiatif dan keberanian utk menempuh perjalanan menjemputnya, emas segunung di depan mata yg ditakdirkan utk kita pun tetap hanya bisa kita nikmati dengan memandang sambil berkhayal " seandainya, seandainya, seandainya..". Dan yang lebih menyakitkan lagi, Tidak lama kemudian kita melihat ada orang lain yang malah sedang mengambil dan menggotongnya. Mungkin skenario dan peran berubah, karena orang yg ditakdirkan jadi sang pemain utama , tidak mau menjalankan perannya .. Daripada mubazir mungkin ya.. 😄 Sama seperti makanan yg diberikan untuk kita di depan mata kita. Karena kita tidak berusaha memakannya , maka akhirnya itu jadi rezeki lalat.. Daripada mubazir..😄 Mungkin teori ini terkesan mengada2 dan sok tau atau apalah. Tapi dengan mempercayai teori ini, telah mengubah sikap, karakter dan hidup banyak orang.. Rezeki gak kemana, dia diam di sana menunggu dijemput. Dan jika tidak kita jemput, ada yg siap menggantikan peran kita, daripada mubazir.. 😊 #Muna  Leader Kmc Azaria
#Muna!!! 😘😘😘
Mielle #Organics #Pomegranate & #Honey bundle includes the Leave-In Conditioner, Twisting Soufflé, Curl Smoothie and Curling Custard. Perfect for 4C textures, these products are made with the finest ingredients to give long lasting moisture for dry thirsty #curls.

www.munacosmetics.com

#conditioner #smoothie #souffle #enhancing #custard #jumianigeria #shopkonga #muna #munacosmetics
Un placer volver a un sitio en el que la innovación, la calidad y la buena cocina se unen en cada plato @munarestaurante gracias samu por hacerlo posible. La bomba de te, la tostá de trucha queso y remolacha, la croqueta de cecina, el pulpo a la brasa, la merluza con salsa de pimiento y el canelon de presa espectaculares; pero el gazpacho con tartar de bonito y el arroz de placton con percebes me dejaron sin palabras y de los postres ya ni hablamos. #food #gastronomia #triponadvisor #muna #eltaimola #elnandusmola #enelbierzotambiensecocina
Un placer volver a un sitio en el que la innovación, la calidad y la buena cocina se unen en cada plato @munarestaurante gracias samu por hacerlo posible. La bomba de te, la tostá de trucha queso y remolacha, la croqueta de cecina, el pulpo a la brasa, la merluza con salsa de pimiento y el canelon de presa espectaculares; pero el gazpacho con tartar de bonito y el arroz de placton con percebes me dejaron sin palabras y de los postres ya ni hablamos. #food  #gastronomia  #triponadvisor  #muna  #eltaimola  #elnandusmola  #enelbierzotambiensecocina 
veel viimast õhtut on meil mune, et seista silmitsi kooruvaga
📸Tuuli Tammla

#muna #andriluup #andri4eva #soonlepakarjamõis #viimaneetendus #ootuses
"Ewa Wuna/Silat Muna"
Tarian perang dan senjata khas tradisional yg dimiliki tiap suku di Nusantara adalah bukti sifat patriotisme.
-Jend. Gatot Nurmantyo 
________________________________
#warriors #silat #nusantara #art #knife #mortal #heritage #muna #tradisional #culture #maitewuna #instagram #beladiri #sultrahits #sultratraveler #visitsultra #voolunteer #rumahsinggah #wonderfulindonesia #wonderfulsultra #celebes #rahainfo #raha #budayaindonesia #folk #folkphotography #photography #nikonindonesia #nikon #anakmuda
"Ewa Wuna/Silat Muna" Tarian perang dan senjata khas tradisional yg dimiliki tiap suku di Nusantara adalah bukti sifat patriotisme. -Jend. Gatot Nurmantyo ________________________________ #warriors  #silat  #nusantara  #art  #knife  #mortal  #heritage  #muna  #tradisional  #culture  #maitewuna  #instagram  #beladiri  #sultrahits  #sultratraveler  #visitsultra  #voolunteer  #rumahsinggah  #wonderfulindonesia  #wonderfulsultra  #celebes  #rahainfo  #raha  #budayaindonesia  #folk  #folkphotography  #photography  #nikonindonesia  #nikon  #anakmuda 
Happy weekend 👋👋👋👋
#Legendary_bakeryplanet 
#poshdishAfrica👌👌 #noodles+eggsource 
#Brunch 
#Muna 
#2018 
#ceo
###
Gua Prasejarah cagar budaya liang kabori #weekendmure#muna#raha#sultra#wkdsbatch8
Hallo dulurrr im cooming hihi. Habis piknik nih🤣🤣 #sulawesitenggara 
#sulteng
#muna
#dolan
Rakkaudella tehty ✌🏻😍 Mukavaa lauantai aamua. 😊 #grillikivelä #raisio #hyvääruokaa #grilli #muna #rakkautta #kananmuna #paistettumuna
The long summer has given a lot - pitkä kuuma kesä antanut meille paljon. Tässä vain pintaraapaisu, lisää tulee myöhemmin. This is just a scratch, more will come later! #summer #activity #kesä #puuha #eläimet #animals #flowers #kukat #wildkids #finland #suomi #egg #cat #muna #kissa
ถ้าไม่ลงมือทำ ความสำเร็จมันก็จะไม่ประกฏขึ้น
#muna
ถ้าไม่ลงมือทำ ความสำเร็จมันก็จะไม่ประกฏขึ้น #muna 
@suciindah17 
@nadalayla5842 
@amellyahofifah19 
#muna
@suciindah17 @nadalayla5842 @amellyahofifah19 #muna 
لا تيأس ابدا فغدا يوم اجمل💙✨
.
.
#جلسه_تصويري #فيكاتي #رومنتك #رومنتكا #mano #muna
Waltham linked up last night at the event. Music artist @indigomuna and @debo617 came out to support @art_By_carter and his collaborative line with @alexisifill 
#ourlavishculture #lavishliving #bostonmusic #hiphop #radio #genre #musicblog #itunes #singer #muna #musicblog #riccardiboston #beatsbydre #iphonex #producer #latest #ck  #musically #soundcloud #Fashion  #newyork #fashionshow #blackpicasso  #middleeastclub #sonia #hit #musically #nyfw #itunes #LA #Summer #art #artbycarter
Waltham linked up last night at the event. Music artist @indigomuna and @debo617 came out to support @art_By_carter and his collaborative line with @alexisifill #ourlavishculture  #lavishliving  #bostonmusic  #hiphop  #radio  #genre  #musicblog  #itunes  #singer  #muna  #musicblog  #riccardiboston  #beatsbydre  #iphonex  #producer  #latest  #ck  #musically  #soundcloud  #Fashion  #newyork  #fashionshow  #blackpicasso  #middleeastclub  #sonia  #hit  #musically  #nyfw  #itunes  #LA  #Summer  #art  #artbycarter 
Maybelline The Colossal Volum Express #Mascara creates full body, high-volume lashes in a single stroke. The full contact brush, with its specially shaped curve, grasps and loads lashes for a fanned out, eye-popping, full body fringe, and give your eye #makeup that pop of a finishing touch.  It works magic on tiny lashes. Patented Mega Brush + unique Formula plump lashes one by one.  Even dramatizes corner lashes other brushes miss—or worse, mess.  Don't flake or clump.  Fragrance free.  Ophthalmologist and allergy tested. Safe for contact lens wearers.

www.munacosmetics.com

#makeuptutorial #makeupartist #muanigeria #maybelline #eyemakeup #muna #mua #munacosmetics
Maybelline The Colossal Volum Express #Mascara  creates full body, high-volume lashes in a single stroke. The full contact brush, with its specially shaped curve, grasps and loads lashes for a fanned out, eye-popping, full body fringe, and give your eye #makeup  that pop of a finishing touch. It works magic on tiny lashes. Patented Mega Brush + unique Formula plump lashes one by one. Even dramatizes corner lashes other brushes miss—or worse, mess. Don't flake or clump. Fragrance free. Ophthalmologist and allergy tested. Safe for contact lens wearers. www.munacosmetics.com #makeuptutorial  #makeupartist  #muanigeria  #maybelline  #eyemakeup  #muna  #mua  #munacosmetics 
Friday tunage - low key #teganandsara cover by #muna #conxcovers #musicislife #musicislove #music #whenwordsfail #musicspeaks #illtellyounow #likeiguessishouldhavetoldyouthen #thethundermoves #likedamndrawersslamminginmyframe #slamminginmyframework

I miss you now
I guess like I should have missed you then
My body moves
Like curtains waving in and out of wind
In and out of windows
I can't untangle (I can't untangle)
What I feel and what would matter most
I can't close an eye (I can't close an eye)-lid
Now there's just no point
In reaching out for me

In the dark (I'm in the dark)
I'm just no good at giving relief
In the dark (I'm in the dark)
It won't be easy to find relief
And I'm not proud (and I'm not proud)
That nothing will seem easy about me
But I promise this
I won't go my whole life
Telling you I don't need

I'll tell you now
I guess like I should have told you then
The thunder moves
Like damn drawers slamming in my frame
Slamming in my framework
I can't untangle (I can't untangle)
What I know and what should matter most
I can't close an eye (I can't close an eye)-lid
Now there's just no point
In reaching out for you

In the dark (I'm in the dark)
I'm just no good at giving relief
In the dark (I'm in the dark)
It won't be easy to find relief
And I'm not proud (and I'm not proud)
That nothing will seem easy about me
But I promise this
(I promise this)
I won't go my whole life
(I promise this)
Telling you I don't need
(I promise this)
Friday tunage - low key #teganandsara  cover by #muna  #conxcovers  #musicislife  #musicislove  #music  #whenwordsfail  #musicspeaks  #illtellyounow  #likeiguessishouldhavetoldyouthen  #thethundermoves  #likedamndrawersslamminginmyframe  #slamminginmyframework  I miss you now I guess like I should have missed you then My body moves Like curtains waving in and out of wind In and out of windows I can't untangle (I can't untangle) What I feel and what would matter most I can't close an eye (I can't close an eye)-lid Now there's just no point In reaching out for me In the dark (I'm in the dark) I'm just no good at giving relief In the dark (I'm in the dark) It won't be easy to find relief And I'm not proud (and I'm not proud) That nothing will seem easy about me But I promise this I won't go my whole life Telling you I don't need I'll tell you now I guess like I should have told you then The thunder moves Like damn drawers slamming in my frame Slamming in my framework I can't untangle (I can't untangle) What I know and what should matter most I can't close an eye (I can't close an eye)-lid Now there's just no point In reaching out for you In the dark (I'm in the dark) I'm just no good at giving relief In the dark (I'm in the dark) It won't be easy to find relief And I'm not proud (and I'm not proud) That nothing will seem easy about me But I promise this (I promise this) I won't go my whole life (I promise this) Telling you I don't need (I promise this)
"Mukena Polos Exclusive By Vanzaa Collection
Bahan rayon janger, sangat adem dan nyaman dipakai di Daerah Tropis khusunya indonesia. tekstur kain halus dan lembut cocok dipakai untuk sholat sehari hari motif lucu
ukuran super jumbo / dewasa. Selain kenyamanan dalam beribadah membawa kesan Simple elegan tentunya cantik....
---------------------------------------------------------------
MOHON DI PERHATIKAN
BARANG YANG KAMI JUAL ADALAH PRODUCT ORIGINAL BY VANZAA COLLECTION BALI
Setiap barang Berlabelkan Vanzaa Collection
Jika ada barang lebih murah bisa jadi barang tersebut bukan milik kami dan tidak menggunakan label vanzaa. so jangan tergiur dengan harga murah ya.
Makasih... -------------------------------------------------------------------
SIZE  XXL / Super Jumbo
Panjang atas = 128 cm
Panjang bawah = 113cm
Lebar bawah = 80 cm
Lingkar rok = 160 cm .
-------------------------
PRICE IDR 115 K
-------------------------
SIZE XL / Jumbo
Panjang atas = 120 cm
Panjang bawah = 113cm
Lebar bawah = 70 cm
Lingkar rok = 140 cm .
-------------------------
PRICE IDR 105 K
-------------------------
SIZE M/L /Standard (no rempel)
Panjang atas = 116 cm
Panjang bawah = 113cm
Lebar bawah = 70cm
Lingkar rok = 140 cm
-------------------------
PRICE IDR 95 K
-------------------------
PENGIRIMAN DARI DENPASAR
Grosir Contact
wa: 081239000646
"
#langara #andolo #baubau #raha #wangiwangi #wakatobi #muna #munabarat #sawerigadi #kendari #luwuk #banggai #banawa #donggala #morowali #parigi #poso #sigi #ampana #tolitoli #palu #bitung #minahasa #ratahan #kotamobagu #manado #tomohon #majene #mamasa #mamuju
"Mukena Polos Exclusive By Vanzaa Collection Bahan rayon janger, sangat adem dan nyaman dipakai di Daerah Tropis khusunya indonesia. tekstur kain halus dan lembut cocok dipakai untuk sholat sehari hari motif lucu ukuran super jumbo / dewasa. Selain kenyamanan dalam beribadah membawa kesan Simple elegan tentunya cantik.... --------------------------------------------------------------- MOHON DI PERHATIKAN BARANG YANG KAMI JUAL ADALAH PRODUCT ORIGINAL BY VANZAA COLLECTION BALI Setiap barang Berlabelkan Vanzaa Collection Jika ada barang lebih murah bisa jadi barang tersebut bukan milik kami dan tidak menggunakan label vanzaa. so jangan tergiur dengan harga murah ya. Makasih... ------------------------------------------------------------------- SIZE XXL / Super Jumbo Panjang atas = 128 cm Panjang bawah = 113cm Lebar bawah = 80 cm Lingkar rok = 160 cm . ------------------------- PRICE IDR 115 K ------------------------- SIZE XL / Jumbo Panjang atas = 120 cm Panjang bawah = 113cm Lebar bawah = 70 cm Lingkar rok = 140 cm . ------------------------- PRICE IDR 105 K ------------------------- SIZE M/L /Standard (no rempel) Panjang atas = 116 cm Panjang bawah = 113cm Lebar bawah = 70cm Lingkar rok = 140 cm ------------------------- PRICE IDR 95 K ------------------------- PENGIRIMAN DARI DENPASAR Grosir Contact wa: 081239000646 " #langara  #andolo  #baubau  #raha  #wangiwangi  #wakatobi  #muna  #munabarat  #sawerigadi  #kendari  #luwuk  #banggai  #banawa  #donggala  #morowali  #parigi  #poso  #sigi  #ampana  #tolitoli  #palu  #bitung  #minahasa  #ratahan  #kotamobagu  #manado  #tomohon  #majene  #mamasa  #mamuju 
Operation catch them young for CRITICAL THINKING, PROBLEM SOLVING, NEGOTIATION, LOBBYING and PRACTICAL LEADERSHIP SKILLS
.
.
Sign up your child with us next year. We know how to do what we do
.
.
#muna #problemsolving #criticalthinking #modelun #modeldiplomacy #unitednations 📸: @mefolere
Hello les copains 👋🏻
.
Encore une fois... Que regarde Muna ?
.

Reponse au petit jeu d'hier... Muna regardait un papillon qui est passé à toute vitesse devant nous pour aller se poser un peu plus loin ! Bravo @via_thegoldengirl  et @helloreo__  qui ont trouvé ! 😀
.
(Bon, après ça elle a essayé de manger le papillon 😡 Je ne sais pas pourquoi mais elle adore tenter d'attraper tout ce qui vole !! Heureusement le papillon s'est vite envolé ! 🦋)
.
Et ici alors, elle regarde quoi ? 😂 Et bien j'avoue que je ne sais pas !! Mais ça à l'air très intéressant.... Faites vos propositions ! 😂 Personnellement je pense à un poisson, sauf qu'ils sont rares dans cette partie de la rivière donc bon... 😂🐟🐠
.
.

Partenaires : @chloemywoof
@petseeh_hyenna
@the_swiss_shepherd_life
@bahia.border
@malobergeraustralien
@louna_dalma
@via_thegoldengirl
.
#dog#dogs#chien#chiens#instadog#instachien#instapet#corse#corsica#corsicandog#corsicandogfamily#instacorse#instacorsica#muna#griffon#bellaandmunadogs#photo#photographie#photography#griffin#fauvedebretagne#holidays#river#bocognano
Hello les copains 👋🏻 . Encore une fois... Que regarde Muna ? . Reponse au petit jeu d'hier... Muna regardait un papillon qui est passé à toute vitesse devant nous pour aller se poser un peu plus loin ! Bravo @via_thegoldengirl et @helloreo__ qui ont trouvé ! 😀 . (Bon, après ça elle a essayé de manger le papillon 😡 Je ne sais pas pourquoi mais elle adore tenter d'attraper tout ce qui vole !! Heureusement le papillon s'est vite envolé ! 🦋) . Et ici alors, elle regarde quoi ? 😂 Et bien j'avoue que je ne sais pas !! Mais ça à l'air très intéressant.... Faites vos propositions ! 😂 Personnellement je pense à un poisson, sauf qu'ils sont rares dans cette partie de la rivière donc bon... 😂🐟🐠 . . Partenaires : @chloemywoof @petseeh_hyenna @the_swiss_shepherd_life @bahia.border @malobergeraustralien @louna_dalma @via_thegoldengirl . #dog #dogs #chien #chiens #instadog #instachien #instapet #corse #corsica #corsicandog #corsicandogfamily #instacorse #instacorsica #muna #griffon #bellaandmunadogs #photo #photographie #photography #griffin #fauvedebretagne #holidays #river #bocognano 
By 2020, entrepreneurs with problem solving, critical thinking and negotiation skills will rule the 🌍 of business
.
.
By 2020, employees with the same skillset will make those without the skills obsolete
.
.
By 2020, students who have these skills will outperform, outsmart, outshine, overrun and instruct those that don’t have. Source: world Economic Forum
.
.
The question is: what are you INTENTIONALLY doing about it?
.
.
We can help! Kindly get in touch with us +2349073431570 or info@modelunacademy.org
.
.
#muna #problemsolving #criticalthinking #negotiation #intentionalliving #beintentional #modeldiplomacy #nationaldevelopment #internationalaffairs #unitednations #modelun #sdg4 #sdg5 #worldeconomicforum
.
.
📸: @euqina_photography
By 2020, entrepreneurs with problem solving, critical thinking and negotiation skills will rule the 🌍 of business . . By 2020, employees with the same skillset will make those without the skills obsolete . . By 2020, students who have these skills will outperform, outsmart, outshine, overrun and instruct those that don’t have. Source: world Economic Forum . . The question is: what are you INTENTIONALLY doing about it? . . We can help! Kindly get in touch with us +2349073431570 or info@modelunacademy.org . . #muna  #problemsolving  #criticalthinking  #negotiation  #intentionalliving  #beintentional  #modeldiplomacy  #nationaldevelopment  #internationalaffairs  #unitednations  #modelun  #sdg4  #sdg5  #worldeconomicforum  . . 📸: @euqina_photography
Don't miss it😝😝😝have a great weekend
#Legendary_bakeryplanet 
#poshdishAfrica👌👌 #agbado
#Goodfriday
#evening
#Muna
#Ceo
#2018 
###
Dirgahayu RI 73🇮🇩
#muna #maitewuna
Regrann from @jacob_roni - 
Bawa bendera lari ke Hutan 
Bendera dibawa si pria bersepatu
Selamat hari kemerdekaan
73 Tahun Indonesia bersatu 🇮🇩 _________________________
#expolresulawesi_tenggara
#expolresouthsulawesi
#expolreindonesia
#wisatasultra
-
-
#bombana #buton #kendari #butonselatan #baubau
#butontengah #muna
#butonutara #kolaka
#kolakatimur #kolakautara #konawe #konawekepulauan
#konaweselatan #konaweutara
#munabarat #wakatobi
•
Sweet Rabbit 🐰💓😌.
-
Para darle un toque de ternura y amor a la habitación de los más chiquitos 💞.
-
Ya llega el Día del niño 👧🏼🧒🏻👦🏼! Aprovechá y les das un regalo hermoso para ellos 🙂.
-
👉🏻 Decidí tú tamaño y tipo de cuadro 🖼
👉🏻 Elegí tus diseños 😎
👉🏻Hacenos tu pedido Y LISTO!. .
.
📦Hace tu pedido por MD o por email 👇🏻munasolucionescreativas@gmail.com
🚚 Hacemos envíos a todo el país. .
#littlerabbit #decohome #decokids #frames #kids #muna #instadeco #sweet
• Sweet Rabbit 🐰💓😌. - Para darle un toque de ternura y amor a la habitación de los más chiquitos 💞. - Ya llega el Día del niño 👧🏼🧒🏻👦🏼! Aprovechá y les das un regalo hermoso para ellos 🙂. - 👉🏻 Decidí tú tamaño y tipo de cuadro 🖼 👉🏻 Elegí tus diseños 😎 👉🏻Hacenos tu pedido Y LISTO!. . . 📦Hace tu pedido por MD o por email 👇🏻munasolucionescreativas@gmail.com 🚚 Hacemos envíos a todo el país. . #littlerabbit  #decohome  #decokids  #frames  #kids  #muna  #instadeco  #sweet 
Aegumatu klassika, täidetud munad. Kas teed ise või võtad meilt, aga pidupäeva 🎉 puhul lault ta esimesena otsa saab. #muna #täidetudmuna #taasiseseisvumispäev #eestitoit #food
Regrann from @jacob_roni -  bunuh!
tikam dan bunuh saja aku.
rajam lalu siksa ragaku.

itu kah inginmu?
itu kah hasratmu?
lakukan…

sulut amarahmu
teriakan nafsumu
lakukan sesukamu

aku siap menyambut sakitnya
perihnya dicerca, dimaki, dihina

tampar, bakar aku.
hujat aku
dan hunuskan tombakmu padaku.

aku bukan siapa-siapa.
bukan teman sedarahmu
bukan saudara setinggalmu
aku rendah

ya... lampiaskan padaku!
tapi tolong
jangan pada negriku,
Indonesiaku.
Indonesiamu.

_Jance Katherine

_________________________
#expolresulawesi_tenggara
#expolresouthsulawesi
#expolreindonesia
#wisatasultra
-
-
#bombana #buton #kendari #butonselatan #baubau
#butontengah #muna
#butonutara #kolaka
#kolakatimur #kolakautara #konawe #konawekepulauan
#konaweselatan #konaweutara
#munabarat #wakatobi
Regrann from @jacob_roni - bunuh! tikam dan bunuh saja aku. rajam lalu siksa ragaku. itu kah inginmu? itu kah hasratmu? lakukan… sulut amarahmu teriakan nafsumu lakukan sesukamu aku siap menyambut sakitnya perihnya dicerca, dimaki, dihina tampar, bakar aku. hujat aku dan hunuskan tombakmu padaku. aku bukan siapa-siapa. bukan teman sedarahmu bukan saudara setinggalmu aku rendah ya... lampiaskan padaku! tapi tolong jangan pada negriku, Indonesiaku. Indonesiamu. _Jance Katherine _________________________ #expolresulawesi_tenggara  #expolresouthsulawesi  #expolreindonesia  #wisatasultra  - - #bombana  #buton  #kendari  #butonselatan  #baubau  #butontengah  #muna  #butonutara  #kolaka  #kolakatimur  #kolakautara  #konawe  #konawekepulauan  #konaweselatan  #konaweutara  #munabarat  #wakatobi 
Sungai dan Pantai Tamborasi. Sulawesi Tenggara, segala keistimewaan tersaji indah disini.

Berdampingan, menyatu antara air asin dan tawar. Itu disebabkan aliran airnya langsung menuju ke laut, yang jarak hanya beberapa meter saja.

Sementara panjang sungainya hanya sekitar 20 meter, dengan lebar sekitar 10 hingga 15 meter saja. Menjadikan destinasi ini disebut sebagai "Sungai Terpendek di Dunia", juga memiliki keunikan yakni "Dua Destinasi dalam Satu Tempat"... Luar biasa.. _________________________
#expolresulawesi_tenggara
#expolresouthsulawesi
#expolreindonesia
#wisatasultra
-
-
#bombana #buton #kendari #butonselatan #baubau
#butontengah #muna
#butonutara #kolaka
#kolakatimur #kolakautara #konawe #konawekepulauan
#konaweselatan #konaweutara
#munabarat #wakatobi
Sungai dan Pantai Tamborasi. Sulawesi Tenggara, segala keistimewaan tersaji indah disini. Berdampingan, menyatu antara air asin dan tawar. Itu disebabkan aliran airnya langsung menuju ke laut, yang jarak hanya beberapa meter saja. Sementara panjang sungainya hanya sekitar 20 meter, dengan lebar sekitar 10 hingga 15 meter saja. Menjadikan destinasi ini disebut sebagai "Sungai Terpendek di Dunia", juga memiliki keunikan yakni "Dua Destinasi dalam Satu Tempat"... Luar biasa.. _________________________ #expolresulawesi_tenggara  #expolresouthsulawesi  #expolreindonesia  #wisatasultra  - - #bombana  #buton  #kendari  #butonselatan  #baubau  #butontengah  #muna  #butonutara  #kolaka  #kolakatimur  #kolakautara  #konawe  #konawekepulauan  #konaweselatan  #konaweutara  #munabarat  #wakatobi 
Vanmiddag heerlijk wezen wandelen in de #bossen met #Muna #💖 Wij zoeken voor haar een ervaren baas. Heeft u interesse? Neem dan contact op met #DierenopvangMaasland in #Oss #☎️ 0412-638497

#staff #stafford #asieldier #asielhond #shelterdog #dierenasiel #adoptdontshop #ikzoekbaas #goudenmandje #🐕 #🐾 #dierenbescherming #hartvoordieren #forestwalk #qualitytime #genieten #☀️ #happystafford #happydog #verhuisdieren
NGAKAK...!!! BEGINILAH JIKA ORANG MUNA DAN ORANG PRANCIS BERBINCANG. SALING MENGERTI DAN MEMAHAMI SATU SAMA LAIN.

#muna
#orangmuna
#sultra #sulawesitenggara 
#sultra1update
Education doesn't need to happen in an institution, it can happen wherever you are. 
Last shots before takeoff plus some amazing gems from the National Museum of Ecuador.
#muna
#motherland 
#hastalaproxima
Education doesn't need to happen in an institution, it can happen wherever you are. Last shots before takeoff plus some amazing gems from the National Museum of Ecuador. #muna  #motherland  #hastalaproxima 
Aku gelap bukan berarti tidak bisa menyatu dengan Merah Putihku. 😊
#73HUTRI #63HUTBAPAKU #puncak_labora #muna
SHARK ATTACK! 🦈🍆 outtake from our summer douche poster shoot with @klit.osiris... party with us @starbethgreen on Sunday 26 August! Tix from @outsavvy 💩🙌🌵
.
.
.
.
.
#nightclub #party #gay #gayboy #gaysofinstagram #gaylife #londongay #instahomo #instaqueer #homo #queer #lgbtqi #gayboyswag #instagay #grimes #charlixcx #lorde #shamir #robyn #yelle #mia #yearsandyears #muna #stvincent #majorlazer #chvrches #janellemonae #dieantwoord #kimpetras #gaylondon
SHARK ATTACK! 🦈🍆 outtake from our summer douche poster shoot with @klit.osiris... party with us @starbethgreen on Sunday 26 August! Tix from @outsavvy 💩🙌🌵 . . . . . #nightclub  #party  #gay  #gayboy  #gaysofinstagram  #gaylife  #londongay  #instahomo  #instaqueer  #homo  #queer  #lgbtqi  #gayboyswag  #instagay  #grimes  #charlixcx  #lorde  #shamir  #robyn  #yelle  #mia  #yearsandyears  #muna  #stvincent  #majorlazer  #chvrches  #janellemonae  #dieantwoord  #kimpetras  #gaylondon 
Semoga kelak kamu akan pakai seragam ini nak 🙏
.
.
.
.
#dirgahayuindonesia73 
#muna
#Tongkuno
#wakurucity
🇦🇿Ressamliq dersi. 🎨 👩‍🎨 yazilmaga telesin!✅
🇷🇺Урок рисования.🎨👩‍🎨 спешите к нам записаться!✅
Ətraflı məlumat üçün:
📞(+99455) 350 07 77;
📞(+99450) 345 57 15;
📞(+99412) 436 89 52
📍Mirza Fatali Axundov, 164 (keçmiş 6-cı Parallel, Favorit marketin yaxınlığında)
#cloudsbymuna #muna #clouds #school #drawing #painting #acrylicpainting #oilpainting #kids #ressamliqakademiyasi #ressamliq #usaqlar #mekteb  #дети #рисование #курсырисования #baku #azerbaijan
🇦🇿Ressamliq dersi. 🎨 👩‍🎨 yazilmaga telesin!✅ 🇷🇺Урок рисования.🎨👩‍🎨 спешите к нам записаться!✅ Ətraflı məlumat üçün: 📞(+99455) 350 07 77; 📞(+99450) 345 57 15; 📞(+99412) 436 89 52 📍Mirza Fatali Axundov, 164 (keçmiş 6-cı Parallel, Favorit marketin yaxınlığında) #cloudsbymuna  #muna  #clouds  #school  #drawing  #painting  #acrylicpainting  #oilpainting  #kids  #ressamliqakademiyasi  #ressamliq  #usaqlar  #mekteb  #дети  #рисование  #курсырисования  #baku  #azerbaijan 
Anggota Paskibraka 2017 REMATIG
sukses trs sodara
.
.
.
.
.
.
.
.
#paskibraka#purnapaski2017#sultra#muna#