an online Instagram web viewer

#hiit medias

Photos

Coming to the studio for a good sweat sesh? Let your friends know! 💪💦 Head on over to our Facebook, and CHECK IN when you arrive at the studio to be entered in to WIN some awesome OTF swag! 
Winners will be announced monthly! 
Be sure to make your check-in PUBLIC so we can see it!
Good luck everyone! 
_______________
Vous venez en studio pour brûler des calories à profusion? Dites-le à vos amis! 💪💦 Rendez-vous sur notre page Facebook et ENREGISTREZ-VOUS en arrivant au studio pour courir la chance de GAGNER de fabuleux cadeaux promotionnels OTF! 
Le nom des gagnants sera annoncé sur une base mensuelle! 
Assurez-vous de vous enregistrer en mode PUBLIC afin que nous puissions le voir! Bonne chance à tous!
.
.
.
.
.
.
.
.
#otftmr #otfcanada #otfnation#otf#keepburning #noexcuses#orangezone#allout #HIIT #instafit#Orangetheoryfitness
#demarrezvotretransformation#misenforme#fitness
Coming to the studio for a good sweat sesh? Let your friends know! 💪💦 Head on over to our Facebook, and CHECK IN when you arrive at the studio to be entered in to WIN some awesome OTF swag! Winners will be announced monthly! Be sure to make your check-in PUBLIC so we can see it! Good luck everyone! _______________ Vous venez en studio pour brûler des calories à profusion? Dites-le à vos amis! 💪💦 Rendez-vous sur notre page Facebook et ENREGISTREZ-VOUS en arrivant au studio pour courir la chance de GAGNER de fabuleux cadeaux promotionnels OTF! Le nom des gagnants sera annoncé sur une base mensuelle! Assurez-vous de vous enregistrer en mode PUBLIC afin que nous puissions le voir! Bonne chance à tous! . . . . . . . . #otftmr  #otfcanada  #otfnation #otf #keepburning  #noexcuses #orangezone #allout  #HIIT  #instafit #Orangetheoryfitness  #demarrezvotretransformation #misenforme #fitness 
Chest & Abs today... I can't wait to start seeing some gains #Gains #Progress #FitFam #Focused #KeepGoing #LiftHeavy #LiftHeavy #HIIT #Cardio #WeightTraining #CuttingSeason #DrinkMoreWater #Fitness
I'm on a 7 day work trip and we scored a beautiful home on airbnb. South TX has been hit with severe tropical storms so I decided to get a workout in.  I downloaded the #Fitify app and it's great! You can customize your workouts with the workout gear you have.  #kettlebellworkout #kettlebell #exercise #work #hiit #weightloss #healthy
New blogpost up now 💗 HAVE YOUR CAKE AND EAT IT (LITERALLY) 💗🍰 kellyfrancisbell.com (link in bio)

#health #wellbeing #fitness #cake #eatwell #food #hiit #kettlebells #running #fitmum #fitmom #mindfulness #home #teaandcake
Motivés, no pain no gain 🤙🏼🏋️‍♂️
#💪 #teamshape #igers #fitness #hiit #love #propulsion #team #lofting #frinds
There’s still time to get fit for summer. Check out our FREE 1 week trial!  You can sign up at the 🔗 in our bio. 
#srq #srqlife #srqfitness #functionaltraining #hiit #fitness #fitfam
Got our HIITMills ➕ HIITBikes delivered today. Ohh the fun that's about to go down🙊
.
.
.
#july9 #hiitmill #hiitbike #hiit #strength #boxing #recovery #westminsterco #denvergym #bouldergym #fitnessplayground #fitfamily #community #comingsoon #fitnessfranchise #enrgifitness #workrecoverrepeat
Sometimes, less is more.

As you learn more about your athletes, you'll learn when they need encouragement, need to hear you yell, or when they only need silence to work on their own.
Sometimes, less is more. As you learn more about your athletes, you'll learn when they need encouragement, need to hear you yell, or when they only need silence to work on their own.
Fit&Salty's mission is to make people salty. Trough sweat in Surfit classes and trough Salty water and sweat in surf lessons ... both of the options being the perfect way to achieve a healthy and happy brain and body!  #getfit #getsalty #surf #surfit #healthylifestyle #loveyourself #loveyourbody #yourbodyistheonlyoneyouhave #choosesalty #saltyhair #lovetosweat #workout #hiit #surfergirl
6 months between these two pictures.  Feel so proud of how far I've come. I still see my  face as it is on the right and it's not until I see a photo that I can realise the difference. I cannot wait to do another picture like this in 6 months time and see how far I have come then 🤞🏼. .
.
.
#90daysss #90daysssplan #joewickes #thebodycoach #weightloss #weightlossjourney #fitness #fitfam #healthy #healthyliving #healthylifestyle #cleanandlean #healthyeating #workout #exercise #weights #HIIT #progress #cleaneating #leanin15 #90daysssgraduate #graduate #journey #progresspics
6 months between these two pictures. Feel so proud of how far I've come. I still see my face as it is on the right and it's not until I see a photo that I can realise the difference. I cannot wait to do another picture like this in 6 months time and see how far I have come then 🤞🏼. . . . #90daysss  #90daysssplan  #joewickes  #thebodycoach  #weightloss  #weightlossjourney  #fitness  #fitfam  #healthy  #healthyliving  #healthylifestyle  #cleanandlean  #healthyeating  #workout  #exercise  #weights  #HIIT  #progress  #cleaneating  #leanin15  #90daysssgraduate  #graduate  #journey  #progresspics 
אנחנו כל כך עסוקים כל הזמן בפעילות אירובית שלפעמים אנחנו קצת שוכחים כמה חשוב לחזק את השרירים ולעצב את הגוף. 
עיצוב וחיטוב הגוף מסייעים ליציבה נכונה, מניעת פציעות ומעניקים גמישות ואורך לשרירים שמתקצרים עם השנים.

#fitness #motivation #spinning #spinningclass #hiit #hiitworkout #training #trxworkout #trx #stepup #tabataworkout #tabata #fun #health #bodyworkout #hodhasharon #kfarsaba #הודהשרון #כפרסבא #ספינינג #רצועות #טבטה #שריפתקלוריות #בריאות #אימוניםפונקציונלים #אימוןפונקציונלי #כושר #סטפאפ
אנחנו כל כך עסוקים כל הזמן בפעילות אירובית שלפעמים אנחנו קצת שוכחים כמה חשוב לחזק את השרירים ולעצב את הגוף. עיצוב וחיטוב הגוף מסייעים ליציבה נכונה, מניעת פציעות ומעניקים גמישות ואורך לשרירים שמתקצרים עם השנים. #fitness  #motivation  #spinning  #spinningclass  #hiit  #hiitworkout  #training  #trxworkout  #trx  #stepup  #tabataworkout  #tabata  #fun  #health  #bodyworkout  #hodhasharon  #kfarsaba  #הודהשרון  #כפרסבא  #ספינינג  #רצועות  #טבטה  #שריפתקלוריות  #בריאות  #אימוניםפונקציונלים  #אימוןפונקציונלי  #כושר  #סטפאפ 
Porque a Natureza é Linda 🔆💚. E tudo que ela nos proporciona é maravilhoso aos olhos - a alma e principalmente ao corpo. Invista em saúde - Invista em você 🔆💛👊🏼👊🏼👊🏼. @erva_doce_delivery_ #ervadocealimentofuncional #comidasaudavel #comidadeverdade #instagood #pilates #muaythai #bike #vegan #vegetarian #zumba #crossfit #saude #saudavel #emagrecimento #funcional #fitness #treino #hiit #amigosdacorridarp #corrida #marmitafit #lowcarb #ribeiraopreto #delivery
Porque a Natureza é Linda 🔆💚. E tudo que ela nos proporciona é maravilhoso aos olhos - a alma e principalmente ao corpo. Invista em saúde - Invista em você 🔆💛👊🏼👊🏼👊🏼. @erva_doce_delivery_ #ervadocealimentofuncional  #comidasaudavel  #comidadeverdade  #instagood  #pilates  #muaythai  #bike  #vegan  #vegetarian  #zumba  #crossfit  #saude  #saudavel  #emagrecimento  #funcional  #fitness  #treino  #hiit  #amigosdacorridarp  #corrida  #marmitafit  #lowcarb  #ribeiraopreto  #delivery 
SQUAD GOALS!!! This team absolutely killed their HIIT training at our Grand Opening! 
If you find yourself losing motivation and accountability at the gym, Small Group Training is a great way to get back into a routine and kick your fitness into high gear! Message us for details!
SQUAD GOALS!!! This team absolutely killed their HIIT training at our Grand Opening! If you find yourself losing motivation and accountability at the gym, Small Group Training is a great way to get back into a routine and kick your fitness into high gear! Message us for details!
💙 G Y M  D A Y
•••
Grosse séance je suis restée 1h15 à la salle wouhouuuu 🎉🎊
••••••••••••••••••••••••••••••••••••••••••••••••••••••
Au programme : 15 minutes de vélo juste histoire de bouger mes jambes et de regarder le match par la même occasion ! Puis cours d’abdos-fessiers et ensuite boot camp du jeudi. ••••••••••••••••••••••••••••••••••••••••••••••••••••••
Les dernières 15 minutes étaient assez hard franchement je n’avais plus de jus ! Mais très bonne séance et puis la France a gagné donc bon 😀
••••••••••••••••••••••••••••••••••••••••••••••••••••••
#gym #gymgirl #fitness #fitgirl #fitfrenchies #sport #sporty #cardio #bootcamp #hiit #workout #girl #blonde #photography #photo #paris #french #apple #healthy #abs #summer #france #happy #smile #hello #motivation #mood #nopainnogain #positivity #determination
💙 G Y M D A Y ••• Grosse séance je suis restée 1h15 à la salle wouhouuuu 🎉🎊 •••••••••••••••••••••••••••••••••••••••••••••••••••••• Au programme : 15 minutes de vélo juste histoire de bouger mes jambes et de regarder le match par la même occasion ! Puis cours d’abdos-fessiers et ensuite boot camp du jeudi. •••••••••••••••••••••••••••••••••••••••••••••••••••••• Les dernières 15 minutes étaient assez hard franchement je n’avais plus de jus ! Mais très bonne séance et puis la France a gagné donc bon 😀 •••••••••••••••••••••••••••••••••••••••••••••••••••••• #gym  #gymgirl  #fitness  #fitgirl  #fitfrenchies  #sport  #sporty  #cardio  #bootcamp  #hiit  #workout  #girl  #blonde  #photography  #photo  #paris  #french  #apple  #healthy  #abs  #summer  #france  #happy  #smile  #hello  #motivation  #mood  #nopainnogain  #positivity  #determination 
WORKOUT
120 Push up to Knee Tucks
140 Hanging Hip Raise
120 Rocking Chair Row
500 Fast Feets
120 Side Plank with Rotation
TOTAL = 1000 REPS
#eddiesbootcamp #nevergiveup #keinehalbensachen #trainingscamp #fit #fitness #workout #training #athletic #personaltraining #functionalfitness #functional #bestrong #youvsyou #exercises #bremen #bremencity #focus #finishstrong #life #passion #goals #fitfam #didim #türkiye #hiit #altınkum #sahilde
Feeling like iv smashed it today 💃🏻
——
12 hour shift ✅ back and biceps ✅ 20k+ steps ✅ all the food ✅ still got calories left for later = happy me 😁
—— #motivation #healthylifestyle #protein #foodie #diet #health #onplan #fitness #gym  #glutes #fitfam #HIIT #cardio #weightlifting #transformation #transformationtuesday #workout #training #motivation #weightloss #weightlossjourney #healthyfood #mealprep #IIFYM #backday #squat
Feeling like iv smashed it today 💃🏻 —— 12 hour shift ✅ back and biceps ✅ 20k+ steps ✅ all the food ✅ still got calories left for later = happy me 😁 —— #motivation  #healthylifestyle  #protein  #foodie  #diet  #health  #onplan  #fitness  #gym  #glutes  #fitfam  #HIIT  #cardio  #weightlifting  #transformation  #transformationtuesday  #workout  #training  #motivation  #weightloss  #weightlossjourney  #healthyfood  #mealprep  #IIFYM  #backday  #squat 
Pra você que tem horários apertados, 30 minutos cuidando do corpo com qualidade.

HIPOPRESSIVOS+HIIT

#be4you#trabalhointerdisciplinar#hiit#hipopressivos
this lovely gem is a throwback to 2013 after I lost (at that point) the most weight I ever had(this was weightloss attempt # i dont even know! i lost count lmao). i had lost a total of almost 30lbs. i weighed around 190lbs in this pic! thats 20lbs lighter than I am now!
•
Yes, my weight number now is higher BUT I can say with 100% certainty that the girl I am now at 210lbs is WAY happier with herself then the girl I was at 190lbs 5 years ago. •
a Huge part of weightloss is mental and sometimes it's hard to get past. But this time around, i am learning to love myself through Every stage and it has truly helped me to grow as a person. i do Not regret putting the weight back on (and more) because this time - through every pound lost, i've gained more self love and confidence than Ever before♥️
this lovely gem is a throwback to 2013 after I lost (at that point) the most weight I ever had(this was weightloss attempt # i dont even know! i lost count lmao). i had lost a total of almost 30lbs. i weighed around 190lbs in this pic! thats 20lbs lighter than I am now! • Yes, my weight number now is higher BUT I can say with 100% certainty that the girl I am now at 210lbs is WAY happier with herself then the girl I was at 190lbs 5 years ago. • a Huge part of weightloss is mental and sometimes it's hard to get past. But this time around, i am learning to love myself through Every stage and it has truly helped me to grow as a person. i do Not regret putting the weight back on (and more) because this time - through every pound lost, i've gained more self love and confidence than Ever before♥️
Happy National Selfie Day! We tried to get one with @bniprofessionalreferralgroup but that didn’t work. Thanks to @Mark Whetten with Foresight Security for taking the selfie with me! #nationalselfieday 📷📸
📸📸📸📸📸📸📸📸📸📸📷📷
#WellnessNation #healthylifestyle #healthytip #uptownhealth #squats #summer #triceps #environment #success #planks #fourthofjuly #July4th #riseandgrind #motivation #crossfitter #fitness #jueves #summer #burpees #entrepreneur #instafit #instagood #crossfit #success #Hiit #10X 💯 💪
Happy National Selfie Day! We tried to get one with @bniprofessionalreferralgroup but that didn’t work. Thanks to @Mark Whetten with Foresight Security for taking the selfie with me! #nationalselfieday  📷📸 📸📸📸📸📸📸📸📸📸📸📷📷 #WellnessNation  #healthylifestyle  #healthytip  #uptownhealth  #squats  #summer  #triceps  #environment  #success  #planks  #fourthofjuly  #July4th  #riseandgrind  #motivation  #crossfitter  #fitness  #jueves  #summer  #burpees  #entrepreneur  #instafit  #instagood  #crossfit  #success  #Hiit  #10X  💯 💪
"Your talent is God's gift to you. What you do with it is your gift back to God." Leo Buscaglia

My contribution to #nationalselfieday .
Set out for a 3 miler at a VERY easy pace followed by my ab #hiit workout to embrace the suck of the first day of summer. 
Amazon Music: Glitch Mob Radio
.
.
.
.
.
.

#running #runnersofinstagram #runner #instarunners #instafit #runhappy #runners #runnerscommunity #fitness #marathontraining #happyrunner #run #fitnessofinstagram #gym #motivation #workout #runnersrepost #runitfast #worlderunners #runtexas #outdoors #igrunners #doepicshit #quotes #hiitworkout  #fitstagram #fitspiration
"Your talent is God's gift to you. What you do with it is your gift back to God." Leo Buscaglia My contribution to #nationalselfieday  . Set out for a 3 miler at a VERY easy pace followed by my ab #hiit  workout to embrace the suck of the first day of summer. Amazon Music: Glitch Mob Radio . . . . . . #running  #runnersofinstagram  #runner  #instarunners  #instafit  #runhappy  #runners  #runnerscommunity  #fitness  #marathontraining  #happyrunner  #run  #fitnessofinstagram  #gym  #motivation  #workout  #runnersrepost  #runitfast  #worlderunners  #runtexas  #outdoors  #igrunners  #doepicshit  #quotes  #hiitworkout  #fitstagram  #fitspiration 
HUGE S/O to one of our newest team members & group fitness instructors Madeline Garcia! @madelineelicia Welcome to the @pcfitnesssolutions Family! We love your energy!! 💥💥💪🏼
-
-
📸: @iam_aaronw 
#trainwithapro #luxuryfitness #WeBringFitnessToYou #apartmentfitness #mensfitness #menshealth #womenshealth #womensfitness #igfitness #igfitnessfreaks #igfit #fitnessjourney #fitmoms #fitnessmotivation #fitnessinspiration #createyourstory #weights #weightloss #hiit #hiitlife #weightlossjourney #health #healthandfitness #healthandwellness
HUGE S/O to one of our newest team members & group fitness instructors Madeline Garcia! @madelineelicia Welcome to the @pcfitnesssolutions Family! We love your energy!! 💥💥💪🏼 - - 📸: @iam_aaronw #trainwithapro  #luxuryfitness  #WeBringFitnessToYou  #apartmentfitness  #mensfitness  #menshealth  #womenshealth  #womensfitness  #igfitness  #igfitnessfreaks  #igfit  #fitnessjourney  #fitmoms  #fitnessmotivation  #fitnessinspiration  #createyourstory  #weights  #weightloss  #hiit  #hiitlife  #weightlossjourney  #health  #healthandfitness  #healthandwellness 
“Uma equipe unida nunca irá vacilar. Pode um membro até dar um passo em falso, mas logo alguém estará lá para ajudar.” #dicadonizzo 💭 Estamos juntos!!! 👊🏼
.
#Teamnizzo #Coachnizzo #foco #endersonnizzo #personaltrainer #coach #workout #hiit #trainer #vidasaudavel #gym #saude #emagrecimento #mundobt #health #fitness #weightloss #lifestyle #goodvibes #fitspiration #qualidadedevida #Wellness #mudeseushabitos #befit #instahealth #motivation #instagood #tbt
“Uma equipe unida nunca irá vacilar. Pode um membro até dar um passo em falso, mas logo alguém estará lá para ajudar.” #dicadonizzo  💭 Estamos juntos!!! 👊🏼 . #Teamnizzo  #Coachnizzo  #foco  #endersonnizzo  #personaltrainer  #coach  #workout  #hiit  #trainer  #vidasaudavel  #gym  #saude  #emagrecimento  #mundobt  #health  #fitness  #weightloss  #lifestyle  #goodvibes  #fitspiration  #qualidadedevida  #Wellness  #mudeseushabitos  #befit  #instahealth  #motivation  #instagood  #tbt 
In typical @maxmckee11 fashion, Max had to add a little something extra to his #MyFavouriteThingAboutOTF photo! What did he have to say about #Orangetheory? 
_
“My favourite thing about OTF is my OTF family! Whether we're debating who started on the rower last, or going all out together in class, my #OTFfamily is always friendly, welcoming and motivating! ...Plus, they deal with my awful jokes which is astounding by itself. LOVE MY OTF FAMMM!”
_
On Monday, June 25 we’re celebrating everything you 🧡 about #OTF and we want to know what YOU like the most! All you have to do is take a photo with the splat, post it on Facebook or Instagram explaining your favourite thing about us and we’ll give you a 🆓 towel! Don’t forget to tag us, too! 💪🧡🍊 #OTFWaterloo
In typical @maxmckee11 fashion, Max had to add a little something extra to his #MyFavouriteThingAboutOTF  photo! What did he have to say about #Orangetheory ? _ “My favourite thing about OTF is my OTF family! Whether we're debating who started on the rower last, or going all out together in class, my #OTFfamily  is always friendly, welcoming and motivating! ...Plus, they deal with my awful jokes which is astounding by itself. LOVE MY OTF FAMMM!” _ On Monday, June 25 we’re celebrating everything you 🧡 about #OTF  and we want to know what YOU like the most! All you have to do is take a photo with the splat, post it on Facebook or Instagram explaining your favourite thing about us and we’ll give you a 🆓 towel! Don’t forget to tag us, too! 💪🧡🍊 #OTFWaterloo 
Holiday beach workout 😎 are you up for challenge @the_barbell_fitchick @joanna_finlay 😈
🔹️1 Sip of lager 🍺
🔹️1 Push up with Power Burbee Thruster💪
🔹️15m sprint + dive 🙈
Repeat as many rounds as possible and have fun 😈😏🙈😂 .
.
.
.
.
.
.
.
.
.
.
.
.
#smartpt #notimeforaverage #holiday #summer #malta #beach #workout #sun #tattoo #polishboy  #lean #physique #hiit #fatloss #havefun #bemorehuman
The homie @marykatenapules putting in that work!!! She been doin cardio and abs with me all week and burpees. The face when I say burpees is classic. Key is when you want results you put in the work!!! Get up out that bed and Work. Despite school, homelife, workin Whateva it is!!! How bad do you want that body to be right? What are you will to sacrifice? What you have is a privilege not a chore chore. #letsgo #workout #privelege #discipline #dedication #SickOfIt #proud #confidence #burpees #beast #cardio #hiit #weightloss #weightlossjourney #weightloss #women #womenempowerment #believe #hope #fit #fitspo #fitfam #fitlife #flexibility #mobility #bodybuilding #instagood #teamgottigainz
The homie @marykatenapules putting in that work!!! She been doin cardio and abs with me all week and burpees. The face when I say burpees is classic. Key is when you want results you put in the work!!! Get up out that bed and Work. Despite school, homelife, workin Whateva it is!!! How bad do you want that body to be right? What are you will to sacrifice? What you have is a privilege not a chore chore. #letsgo  #workout  #privelege  #discipline  #dedication  #SickOfIt  #proud  #confidence  #burpees  #beast  #cardio  #hiit  #weightloss  #weightlossjourney  #weightloss  #women  #womenempowerment  #believe  #hope  #fit  #fitspo  #fitfam  #fitlife  #flexibility  #mobility  #bodybuilding  #instagood  #teamgottigainz 
Bonsoir !
Les pâtes c'est la vie non? 
Bon deux jours deux midis des pâtes là à la bolognaise revisitée car ses pas de la viande hachée mais du faux filets.
Cette après midi une séance hiit de justice y m'en reste une encore je la ferai samedi. 
Bonne soirée 💋💋💋
#fitness #futurfitgirl #fitgirlendevenir #onlacherien #teamshape #cardio #muscu #teamgallice #hiit #instafood #instaregimeuse #2018nonauxkilos #training #trainingmaison
✨Happy international day of Yoga! 🙏🏼 Yoga has opened up a world of knowledge and curiosity for me. It is where my fitness journey began and the reason why it never stopped. The body, the mind and how we treat them and feed them are all linked to how we feel. Yoga is a lifestyle, not just an asana. It’s for longevity not vanity. And it’s for everyone, from all walks of life. Thank you to my mentors @nynicci and @yoga4allmankind.  You can never know how much I appreciate the gift you gave me to learn more about this practice and to teach it to others. #namaste #practiceandalliscoming
✨Happy international day of Yoga! 🙏🏼 Yoga has opened up a world of knowledge and curiosity for me. It is where my fitness journey began and the reason why it never stopped. The body, the mind and how we treat them and feed them are all linked to how we feel. Yoga is a lifestyle, not just an asana. It’s for longevity not vanity. And it’s for everyone, from all walks of life. Thank you to my mentors @nynicci and @yoga4allmankind. You can never know how much I appreciate the gift you gave me to learn more about this practice and to teach it to others. #namaste  #practiceandalliscoming 
Sometimes you teach the executive city girl how to be a real deal manual laborer 💪
Nice job @lewlewfresh
Sometimes you teach the executive city girl how to be a real deal manual laborer 💪 Nice job @lewlewfresh
Today has been a goooood food day! Lunch was leftover Jalfrezi and tea was a CYO beef, onion and mushroom pasta, seasoned with a tonne of garlic and I made the sauce from my yoghurt allowance, it was really tasty! I’d make this again. I just had to ignore all of the garlic bread I made for my other half, even though I kept staring at him eating it.. 🙈
Today has been a goooood food day! Lunch was leftover Jalfrezi and tea was a CYO beef, onion and mushroom pasta, seasoned with a tonne of garlic and I made the sauce from my yoghurt allowance, it was really tasty! I’d make this again. I just had to ignore all of the garlic bread I made for my other half, even though I kept staring at him eating it.. 🙈
The more difficult the work out, the greater the satisfaction 💥💥
Join us at @trainatelevate for your first free class .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
#YouCanDoIt #ElevateDC #TrainHard #gym #workout #fit #fitness #fitnessmotivation #fitfam #fitlife #GetFit #Goals #DCFitness #BestGymDC #HIIT #TrainElevate #ElevateYourFitness #Train #hiitworkout #hiittraining #HighIntensity #endurance #enduranceathlete #tbt
En plein tournage de PUMPING IRON 3📹🔥💥😎
▫ Avec mes partenaires d'entraînement @will_coach_u et @coach_alfie.caballero. ▫
▪
▪ ➖➖➖➖➖➖➖➖➖➖➖➖➖➖
VOS OBJECTIFS = MA MOTIVATION !!
➖➖➖➖➖➖➖➖➖➖➖➖➖➖
DEMANDE LE MEILLEUR POUR TOI CAR TU LE MÉRITES
➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖
Vous voulez changer ?
💻CONTACT: powertraining@outlook.fr
➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖
📝N'hésitez pas à me contacter :
◽prise de masse
◽pertes de poids
◽renforcement musculaire
◽Préparation physique générale
◽Conseils alimentaire et compléments ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖
💻SITE WEB: juanitocoaching.com
➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖
OBTENEZ ENFIN DES RÉSULTATS 🏁💪
➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖
📸 SNAP : juanitoisback
📱FACEBOOK: Juanito Ciordia
➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖
🎥 YOUTUBE : www.youtube.com/c/juanitopowertraining ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ #abs #determination #objectif #gym #fitnessaddict #fitfam #fitfrenchies #muscle #musculation #igfitness #instamoment  #eatclean #healthy #motivation  #shredded #mensphysiquepic #teamshape #bodybuilding #french #fit #photooftheday #protein #body #legs #hiit
En plein tournage de PUMPING IRON 3📹🔥💥😎 ▫ Avec mes partenaires d'entraînement @will_coach_u et @coach_alfie.caballero. ▫ ▪ ▪ ➖➖➖➖➖➖➖➖➖➖➖➖➖➖ VOS OBJECTIFS = MA MOTIVATION !! ➖➖➖➖➖➖➖➖➖➖➖➖➖➖ DEMANDE LE MEILLEUR POUR TOI CAR TU LE MÉRITES ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ Vous voulez changer ? 💻CONTACT: powertraining@outlook.fr ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 📝N'hésitez pas à me contacter : ◽prise de masse ◽pertes de poids ◽renforcement musculaire ◽Préparation physique générale ◽Conseils alimentaire et compléments ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 💻SITE WEB: juanitocoaching.com ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ OBTENEZ ENFIN DES RÉSULTATS 🏁💪 ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 📸 SNAP : juanitoisback 📱FACEBOOK: Juanito Ciordia ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ 🎥 YOUTUBE : www.youtube.com/c/juanitopowertraining ➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖➖ #abs  #determination  #objectif  #gym  #fitnessaddict  #fitfam  #fitfrenchies  #muscle  #musculation  #igfitness  #instamoment  #eatclean  #healthy  #motivation  #shredded  #mensphysiquepic  #teamshape  #bodybuilding  #french  #fit  #photooftheday  #protein  #body  #legs  #hiit 
If you can only get to #speedflexwestbyfleet 2 x per week then this membership may be perfect for you #totalbodyworkout #hiit #personaltrainerlead #getresults #surrey
Determination outweighs Discomfort..... “TopSpin” Tennis meets fitness. 
#tennis #excercise #babolattennis #hiit #groupexercise #hiittraining #usta #fitness #fitfam #fit #stamford #ct #darien #stamvegas #inspire #quotes
Free giveaway!!
🏋🏽‍♂️
To enter simply follow us @ikarus_athletics, then leave a comment telling us your favorite workout and tag 1 friend!!
💪🏽
Enter as many times as you would like by following the rules above.
🏆
Winner will be chosen at random at 12pm Sunday. Shipping within the United States only.
Free giveaway!! 🏋🏽‍♂️ To enter simply follow us @ikarus_athletics, then leave a comment telling us your favorite workout and tag 1 friend!! 💪🏽 Enter as many times as you would like by following the rules above. 🏆 Winner will be chosen at random at 12pm Sunday. Shipping within the United States only.
Thanks for the cookies, you're still gonna get destroyed though 🍪😉😂 PROPER CHAMP!! 👏🏻👏🏻👏🏻
.
#thehiitboss #thb #hiitmeup #fitness #fatburn #strength #endurance #hiit #highintensity #intervaltraining #fatloss #cardio #health #fullbodyworkout #muscle #stronger #youvsyou #bethebestyou #pt #personaltrainer #hastings #motivation #encouragement #guidance #support #challengeyourself #noexcuses
Maybe not the smartest choice after some heavy celebrating in Vegas. Let's just say I'm really happy I have a bathroom right next to my erg. The trouble started 1k in. 💩💩 The 2k project had begun... Is the Holy Grail achievable 🤷 current PB 6:21.3
Maybe not the smartest choice after some heavy celebrating in Vegas. Let's just say I'm really happy I have a bathroom right next to my erg. The trouble started 1k in. 💩💩 The 2k project had begun... Is the Holy Grail achievable 🤷 current PB 6:21.3
Meet some of my trainers 😍I was fortunate enough to take a picture with them on my trip to Cancun. One of the MANY highlights of the trip🙌🏻
•
•
Each of this trainers I have a special bond with @thechrisdowning  he’s the most down to earth person and caring. I had a change to workout with him last year 😍and just when I was about to stop he gave me that motivation to keep going
•
•
@autumncalabrese well with her 80 day program she got myself slimming and some definition on my body •
•
And now @joelfreemanfitness he’s gonna help me stay fit this summer with his new program that’s only 4 days, you get the weekend off, a cheat meal, and it’s only 30 min 🙌🏽
•
•
People say you can’t get a good workout at home 🙄 but any workout will get you results as long as you put in the work. My trainers kick my butt every time and I definitely get results.
•
•
 My next success group starts July 16th, What is your why? Do you want to feel better? Look better? Have more energy? Do you struggle with confidence? Or even anxiety and depression? Let me help you! •
•
You'd be surprised how much it helps to be in a group surrounded by like minded, positive and supportive people who are all working towards similar goals! It's time to do something for YOU! ❤️ Let’s Chat!
Meet some of my trainers 😍I was fortunate enough to take a picture with them on my trip to Cancun. One of the MANY highlights of the trip🙌🏻 • • Each of this trainers I have a special bond with @thechrisdowning he’s the most down to earth person and caring. I had a change to workout with him last year 😍and just when I was about to stop he gave me that motivation to keep going • • @autumncalabrese well with her 80 day program she got myself slimming and some definition on my body • • And now @joelfreemanfitness he’s gonna help me stay fit this summer with his new program that’s only 4 days, you get the weekend off, a cheat meal, and it’s only 30 min 🙌🏽 • • People say you can’t get a good workout at home 🙄 but any workout will get you results as long as you put in the work. My trainers kick my butt every time and I definitely get results. • • My next success group starts July 16th, What is your why? Do you want to feel better? Look better? Have more energy? Do you struggle with confidence? Or even anxiety and depression? Let me help you! • • You'd be surprised how much it helps to be in a group surrounded by like minded, positive and supportive people who are all working towards similar goals! It's time to do something for YOU! ❤️ Let’s Chat!
A big week for the sled pushes! 🔥
A big week for the sled pushes! 🔥
Aquí se SUDA! Y solo aquí te DIVIERTES! Strong By Zumba 💪🏾 Martes y Jueves 9:00 a 10:00 #functionaltraining #gye #sbz #ceibosnorte #ceibos #strongbyzumba #guayaquil #fitness #fitnessmotivation #hiit #ecuador #sync #insync #letitsyncin
My Rules is simple...
“I BELIEVE IN YOUR CAPABILITY, SO YOU MUST BELIEVE IN YOURSELF”
If you see someone successful out there, its because the choose to be success, and YOU...!!! Don’t just watch there, make a differences, and start it from you... Live Active, Healthy and keep STRONG... i promise i will always be there to guide you... and let’s TRANSFORM TOGETHER....!!!! This is @strongbyzumba #sync #hiit #music #letitsyncin #fridaymotivation #vibes #believeinyourself #youcandoit #now
My Rules is simple... “I BELIEVE IN YOUR CAPABILITY, SO YOU MUST BELIEVE IN YOURSELF” If you see someone successful out there, its because the choose to be success, and YOU...!!! Don’t just watch there, make a differences, and start it from you... Live Active, Healthy and keep STRONG... i promise i will always be there to guide you... and let’s TRANSFORM TOGETHER....!!!! This is @strongbyzumba #sync  #hiit  #music  #letitsyncin  #fridaymotivation  #vibes  #believeinyourself  #youcandoit  #now 
Looking to amp up your Barre sweat? Add @toneybands during class to add consistent resistance and help build those 💪 Available now for pre-order at $49.95. Ser the front desk to purchase!
.
.
.
.
.
.
.
.
.
#xtendbarre #xtendbarreoldtown #barre #pilates #barrebody #ballet #fitdc #fitfam #extraordinaryalx #johncarlylealexandria #alexandriava #novabarre #novafit #dcbarre #bestofnovamag #hiit #dancecardio #strength #xbotfam #BarreBabes #2018
At that stage where any summer clothes I have from last year are too big and wearing bigger clothes bums me out so headed to the shops after work.
.
The shirt on the left was a yay and the one on the right, a nay.
.
May have made a pit stop @nike 👀
.
.
.
#weightlossjourney #weightloss #fitness #keto #hiit #lowcarb #gym #diet #ketoweightloss #ketofam #iifym #fattofit #strongnotskinny #swolemate #slimmingworlduk #puregym #fitspo #progresspic #slimmingworldprogress #tabataworkout #fitlife #goalweight #fattofit #beforeandafterweightloss #impuregymmotivated #100lbslost #100lbsdown
At that stage where any summer clothes I have from last year are too big and wearing bigger clothes bums me out so headed to the shops after work. . The shirt on the left was a yay and the one on the right, a nay. . May have made a pit stop @nike 👀 . . . #weightlossjourney  #weightloss  #fitness  #keto  #hiit  #lowcarb  #gym  #diet  #ketoweightloss  #ketofam  #iifym  #fattofit  #strongnotskinny  #swolemate  #slimmingworlduk  #puregym  #fitspo  #progresspic  #slimmingworldprogress  #tabataworkout  #fitlife  #goalweight  #fattofit  #beforeandafterweightloss  #impuregymmotivated  #100lbslost  #100lbsdown 
This clean and jerk burpee combo was a #HIIT killer ☠️☠️☠️ Clean and Jerk x 10
Burpees x 15 
15-20 minute #amrap (as many rounds as possible)
This clean and jerk burpee combo was a #HIIT  killer ☠️☠️☠️ Clean and Jerk x 10 Burpees x 15 15-20 minute #amrap  (as many rounds as possible)
DIFFERENCE BETWEEN FAT LOSS AND MUSCLE GAIN by @jmaxfitness -
If you want to build muscle, then the formula is simple: lift weights, and try to get stronger each and every workout (in the 6-12 rep range). Eat high protein (1g/lb), and eat in a Caloric Surplus (BW in lbs x 16-18). Eat enough to gain 2-4lbs per month. Slow is good here as it means most of the weight you gain will be muscle.
-
For fat loss, it's almost the EXACT SAME. Lift in the gym to build muscle and get stronger. This means you'll hold on to as much muscle as possible. Get high protein (to help hold on to muscle), and the only thing that changes is how many calories you eat. You need to eat in a Caloric Deficit (BW in lbs x 10-14 is a good starting point). Aim to lose 1-2lbs per week. Slow is good here as it means that most of the weight you lose will be fat.
-
What about cardio? Well, for muscle gain, you should only do cardio if you want to eat more food without gaining fat, so I'd only recommend this for people with a MASSIVE appetite. For fat loss, I only recommend introducing fat loss if you want to eat bigger meals or if you've plateaued and you're not losing any more fat. It's like being stuck north of the wall, all alone with Whitewalkers.
-
Which are you trying to do? Lose fat, or gain muscle? Let me know below.
-
#buildmuscle #gainmuscle #highintensityintervaltraining #hiit #caloricdeficit #fatloss #weightloss #liftweights #lift #strengthtraining #jmaxfitness #cardio #marathon #iifym #flexibledieting #deadlift #fatlossdiet #squat #benchpress #bodybuilderworkout #fatlossworkout #curlsforthegirls #trisfortheguys #weightlossworkout #workoutroutines #jmaxfitness #muscleman #howtolosefat #liss
DIFFERENCE BETWEEN FAT LOSS AND MUSCLE GAIN by @jmaxfitness - If you want to build muscle, then the formula is simple: lift weights, and try to get stronger each and every workout (in the 6-12 rep range). Eat high protein (1g/lb), and eat in a Caloric Surplus (BW in lbs x 16-18). Eat enough to gain 2-4lbs per month. Slow is good here as it means most of the weight you gain will be muscle. - For fat loss, it's almost the EXACT SAME. Lift in the gym to build muscle and get stronger. This means you'll hold on to as much muscle as possible. Get high protein (to help hold on to muscle), and the only thing that changes is how many calories you eat. You need to eat in a Caloric Deficit (BW in lbs x 10-14 is a good starting point). Aim to lose 1-2lbs per week. Slow is good here as it means that most of the weight you lose will be fat. - What about cardio? Well, for muscle gain, you should only do cardio if you want to eat more food without gaining fat, so I'd only recommend this for people with a MASSIVE appetite. For fat loss, I only recommend introducing fat loss if you want to eat bigger meals or if you've plateaued and you're not losing any more fat. It's like being stuck north of the wall, all alone with Whitewalkers. - Which are you trying to do? Lose fat, or gain muscle? Let me know below. - #buildmuscle  #gainmuscle  #highintensityintervaltraining  #hiit  #caloricdeficit  #fatloss  #weightloss  #liftweights  #lift  #strengthtraining  #jmaxfitness  #cardio  #marathon  #iifym  #flexibledieting  #deadlift  #fatlossdiet  #squat  #benchpress  #bodybuilderworkout  #fatlossworkout  #curlsforthegirls  #trisfortheguys  #weightlossworkout  #workoutroutines  #jmaxfitness  #muscleman  #howtolosefat  #liss 
'Vork' Pie 😍 and they think we just eat lettuce 😁
'Vork' Pie 😍 and they think we just eat lettuce 😁
Exceptionnellement la séance de cross'hiit du dimanche matin sera déplacée au samedi matin de 10h30 à 11h30 une seconde séance est elle placée comme tout les week-end le dimanche de 20h à 21h.
Les 2 séances auront lieu à la plage du phare (alfortville) 
La séance est à 6 euro ou les 4 séances à 20 euros 
La 1 ère séance est offerte 
#crosshiittraining#crossfit#hiit#nopainnogain #gladiateurs#courscollectifs
Exceptionnellement la séance de cross'hiit du dimanche matin sera déplacée au samedi matin de 10h30 à 11h30 une seconde séance est elle placée comme tout les week-end le dimanche de 20h à 21h. Les 2 séances auront lieu à la plage du phare (alfortville) La séance est à 6 euro ou les 4 séances à 20 euros La 1 ère séance est offerte #crosshiittraining #crossfit #hiit #nopainnogain  #gladiateurs #courscollectifs 
Work hard, be proud together!⠀
This week don't forget to visit your studio and tell us why FIT36 makes you ⠀
#STRONGandPROUD ⠀
⠀
#FIT36 #HIIT #HIITFam⠀
#Strong #FitFriends
Fat Burger!!! @fireteamwhiskeymilitaryfitness style!! #keto #hiit #militaryfitness #army #navy #airforce #marines #coastguard #fittofight #alwaysready #warriorspirit #firstresponders #firefighter #leos
Checking out the most expensive private yacht in the world 🛥️🛳️ St Tropez truly is extra 💲 heading home soon after a much needed mental break away from lifting hard.
Checking out the most expensive private yacht in the world 🛥️🛳️ St Tropez truly is extra 💲 heading home soon after a much needed mental break away from lifting hard.
TODAY I WILL...
TODAY I CAN...
#sbzx28 challenge Miri The #SBZx28 Challenge is all about redefining what you’re capable of. You’re on your way. Keep burning, toning, and sweating to the beat.  #sbz #sbzx28 #sbzx28challenge #strong #strongbyzumba #letitsyncin #bodytransformation #hiit #music #sync #sbzresults
Shoulder Day ❤️ here is a piece of my workout. Thanks to @elizabethaylorfitness for the great exercises. My shoulders are definitely fried. Feel free to DM me with any questions. #hustleandgrind #armpump #fitgoals #gymselfie #gymlove #trainingday #fitnation #hiit #activeliving #activelife #activelifestyle #socialenvy #pleaseforgiveme #pushpullgrind #grindout #gymhard #focus #ripped #shredded #swole #squat #sweat #grind #girlsthatlift  #healthylife #fitlife #nike #iam1stphorm #1stphorm #legionofboom
Shoulder Day ❤️ here is a piece of my workout. Thanks to @elizabethaylorfitness for the great exercises. My shoulders are definitely fried. Feel free to DM me with any questions. #hustleandgrind  #armpump  #fitgoals  #gymselfie  #gymlove  #trainingday  #fitnation  #hiit  #activeliving  #activelife  #activelifestyle  #socialenvy  #pleaseforgiveme  #pushpullgrind  #grindout  #gymhard  #focus  #ripped  #shredded  #swole  #squat  #sweat  #grind  #girlsthatlift  #healthylife  #fitlife  #nike  #iam1stphorm  #1stphorm  #legionofboom 
Despite today being majority Abs - Still a fair amount of Calories Burnt and a lot of sweat produced!

#fitness #training #fitnesstraining #healthylifestyle #healthy #lifestyle #motivation #selfie #sweatyselfie #workout #HIIT #hiitworkout #BOD #beachbodyondemand #T25 #shaunt #cardio #absworkout #quickabs #dailycheckin
🍗🌭NEW BLOG POST🍔🍟 Visceral Fat 🌮
Measuring your waist circumference is one of the easiest ways to assess your metabolic health. 🍕
I often can't stress enough to patients the numerous benefits that come with reducing waist size.
🍖
As well as being able to fit into that bikini or those  swim shorts. 🍗
Reducing belly fat leads to 
A reduction in 
cholesterol level
Blood pressure 
Improvement in diabetic/sugar control

Have a read of my new blog post to find out why

askdrgo.com/2018/06/21/belly-fat-the-secret-assassin/
🍗🌭NEW BLOG POST🍔🍟 Visceral Fat 🌮 Measuring your waist circumference is one of the easiest ways to assess your metabolic health. 🍕 I often can't stress enough to patients the numerous benefits that come with reducing waist size. 🍖 As well as being able to fit into that bikini or those  swim shorts. 🍗 Reducing belly fat leads to A reduction in cholesterol level Blood pressure Improvement in diabetic/sugar control Have a read of my new blog post to find out why askdrgo.com/2018/06/21/belly-fat-the-secret-assassin/
💦😅💦
Yesterday was a great sweaty workout! I watched a bit of the movie Hostage during my arc trainer cardio and that def helped push me through! ✨
✨💥💢
My knees were hurting a lot so I added a pad under my knees.  I also modified this workout by using a dead weight medicine ball and pushed it from side to side with a push up in between. ✨
🆎🆎🆎
I used a 10lb bouncy medicine ball but you can do this workout with a lot of different objects! Try plates, the dead weight medicine ball, even step risers! I'll show these variations in the days too come! ✨
🍛🍝🥘
Examples of HIS and HER portion sizes! Control your portions if you're trying to lose weight! ✨
✨✨✨
Enjoy ❣️❣️❣️💪💪
💦😅💦 Yesterday was a great sweaty workout! I watched a bit of the movie Hostage during my arc trainer cardio and that def helped push me through! ✨ ✨💥💢 My knees were hurting a lot so I added a pad under my knees. I also modified this workout by using a dead weight medicine ball and pushed it from side to side with a push up in between. ✨ 🆎🆎🆎 I used a 10lb bouncy medicine ball but you can do this workout with a lot of different objects! Try plates, the dead weight medicine ball, even step risers! I'll show these variations in the days too come! ✨ 🍛🍝🥘 Examples of HIS and HER portion sizes! Control your portions if you're trying to lose weight! ✨ ✨✨✨ Enjoy ❣️❣️❣️💪💪
IT'S PROMO TIME! 💥💥💥
. . .
That's right, we have 2 promos that you can take advantage of during the month of June to get your hands on some 🆓 goodies.
.
👉 Purchase 1 x BCAA/ electrolyte tub and get a free drink bottle (comes with free standard post)

Or
.
👉  Purchase 2 x BCAA/ electrolyte tubs and get a free drink bottle + 5 x choc wpi samples + 
5 x vanilla wpi samples
(comes with free standard post)

How great is that!! 🤘🎉
.
If you've been waiting to try our grass-fed and completely natural WPI then option 2 is for you.
.

Get in quick, offer lasts until the end of the month! Shop online today. Link in bio 🔝🔝
#electrofy #nutrition #fitness
IT'S PROMO TIME! 💥💥💥 . . . That's right, we have 2 promos that you can take advantage of during the month of June to get your hands on some 🆓 goodies. . 👉 Purchase 1 x BCAA/ electrolyte tub and get a free drink bottle (comes with free standard post) Or . 👉 Purchase 2 x BCAA/ electrolyte tubs and get a free drink bottle + 5 x choc wpi samples + 5 x vanilla wpi samples (comes with free standard post) How great is that!! 🤘🎉 . If you've been waiting to try our grass-fed and completely natural WPI then option 2 is for you. . Get in quick, offer lasts until the end of the month! Shop online today. Link in bio 🔝🔝 #electrofy  #nutrition  #fitness 
Hanging out with the Biohacker par excellence @drjaquish - inventor of the OsteoStrong Spectrum, the unique and astonishingly effective equipment for developing skeletal strength and the inventor of the X3 Bar variable resistance training equipment which in a ridiculously short session delivers triple the effect of conventional weight training! Turn yourself into a better and stronger you with minimal time commitment!
Hanging out with the Biohacker par excellence @drjaquish - inventor of the OsteoStrong Spectrum, the unique and astonishingly effective equipment for developing skeletal strength and the inventor of the X3 Bar variable resistance training equipment which in a ridiculously short session delivers triple the effect of conventional weight training! Turn yourself into a better and stronger you with minimal time commitment!
Ok let’s talk about B.O. 😷🤢 I might just be a little crankier this morning with only 4 1/2 hours of sleep last night coz of hubby’s snoring.... BUT seriously! I had to leave my rower mid-row because the person next to me had b.o. so bad I was literally gagging! 🤢 And when you’re trying to go all out and gasping for air, you don’t wanna inhale someone’s stench! 😤😖 It was so bad I couldn’t even finish my workout, I had to leave coz I was gagging so much with every inhale I thought I was going to puke! 🤢🤮 I’m sooo annoyed! #stoptheboplease😷
➖➖➖
Ok rant over... I’m gonna go get myself some coffee and reset. ☕️🧘🏻‍♀️
On another note, anybody run the @nycmarathon and use a particular training plan?? Anybody have any experience with the NYRR virtual training plan?? Any insights would be appreciated. Thanks! ☺️
➖➖➖
3 1/2 weeks before #NewYorkMarathon training starts. I’m getting scared! 😬
•
•
•
•
•
•
•
•
•
•
•
•
#MorningWorkout #StrengthTraining #FitMomStrongMom #StrongNotSkinny #Marathoner #MarathonTraining #BeastMode #StrongerThanYesterday #RunnersLife #GymLife #OTFNation #OrangeTheoryFitness #OTFTustin #OrangeTheoryFitnessTustin #IBurnForMe  #BasePushAllout #SplatPoints #KeepBurning #Fitstagram #FasterThanYesterday #HIIT #BetterSoreThanSorry #IHaveARunnersBody #TheSweatLife #SweatCollective  #RunMatchy™
Ok let’s talk about B.O. 😷🤢 I might just be a little crankier this morning with only 4 1/2 hours of sleep last night coz of hubby’s snoring.... BUT seriously! I had to leave my rower mid-row because the person next to me had b.o. so bad I was literally gagging! 🤢 And when you’re trying to go all out and gasping for air, you don’t wanna inhale someone’s stench! 😤😖 It was so bad I couldn’t even finish my workout, I had to leave coz I was gagging so much with every inhale I thought I was going to puke! 🤢🤮 I’m sooo annoyed! #stoptheboplease 😷 ➖➖➖ Ok rant over... I’m gonna go get myself some coffee and reset. ☕️🧘🏻‍♀️ On another note, anybody run the @nycmarathon and use a particular training plan?? Anybody have any experience with the NYRR virtual training plan?? Any insights would be appreciated. Thanks! ☺️ ➖➖➖ 3 1/2 weeks before #NewYorkMarathon  training starts. I’m getting scared! 😬 • • • • • • • • • • • • #MorningWorkout  #StrengthTraining  #FitMomStrongMom  #StrongNotSkinny  #Marathoner  #MarathonTraining  #BeastMode  #StrongerThanYesterday  #RunnersLife  #GymLife  #OTFNation  #OrangeTheoryFitness  #OTFTustin  #OrangeTheoryFitnessTustin  #IBurnForMe  #BasePushAllout  #SplatPoints  #KeepBurning  #Fitstagram  #FasterThanYesterday  #HIIT  #BetterSoreThanSorry  #IHaveARunnersBody  #TheSweatLife  #SweatCollective  #RunMatchy ™
Ibland behöver jag koffein [dricker inte kaffe]
Då tackar jag gudarna för alla smaskiga NOCCO’s som det finns att välja mellan 🍹
Vilken är din favorit?👌🏻 #noccobcaa #nocco  #actic #hiit  #dinträningskompis #minresaräknas #viktresa #hälsa #träning #crossfit #viktväktare #aktiv #jagtogbeslutet #jagkanjagvill #cf #viktminskning #minviktresa #fitnessmotivation #följdindröm #weightloss #weightlossjourney #jagharviljan #aldrigvila #livsstilsförändring #motmintoppform #wellness #healty #kanjagkandu #fredagsfys #karitraa
Ibland behöver jag koffein [dricker inte kaffe] Då tackar jag gudarna för alla smaskiga NOCCO’s som det finns att välja mellan 🍹 Vilken är din favorit?👌🏻 #noccobcaa  #nocco  #actic  #hiit  #dinträningskompis  #minresaräknas  #viktresa  #hälsa  #träning  #crossfit  #viktväktare  #aktiv  #jagtogbeslutet  #jagkanjagvill  #cf  #viktminskning  #minviktresa  #fitnessmotivation  #följdindröm  #weightloss  #weightlossjourney  #jagharviljan  #aldrigvila  #livsstilsförändring  #motmintoppform  #wellness  #healty  #kanjagkandu  #fredagsfys  #karitraa 
Early birds get all the worms. We know that.

People who set their alarm and wake up to get their workouts in BEFORE the day starts, all get their workouts in.

We know that, TOO!

Most of our highest attendance classes are on our west coast early bird schedule. Every single day of the workweek VFit Studio has you covered with a 530, 6, 630, and 705a LIVE group fitness class with our trainer team.

No excuses. 
You ready to have something to wake up and look forward to? Book a class now to wake up to tomorrow!
.
.
.
.
.
.
#fitness #workout #homegym #willpower #barre #HIIT #vfitstrong #health #exercise #plank #cardio #fitmom #nogym #metime #california #newengland #oregon #training #team #fitspo #603
Early birds get all the worms. We know that. People who set their alarm and wake up to get their workouts in BEFORE the day starts, all get their workouts in. We know that, TOO! Most of our highest attendance classes are on our west coast early bird schedule. Every single day of the workweek VFit Studio has you covered with a 530, 6, 630, and 705a LIVE group fitness class with our trainer team. No excuses. You ready to have something to wake up and look forward to? Book a class now to wake up to tomorrow! . . . . . . #fitness  #workout  #homegym  #willpower  #barre  #HIIT  #vfitstrong  #health  #exercise  #plank  #cardio  #fitmom  #nogym  #metime  #california  #newengland  #oregon  #training  #team  #fitspo  #603